Anti PNMA6A pAb (ATL-HPA045007)

Atlas Antibodies

Catalog No.: ATL-HPA045007-25

Protein Description: paraneoplastic Ma antigen family member 6A
Gene Name: PNMA6A
Alternative Gene Name: MGC15827, PNMA6C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046287: 31%, ENSRNOG00000052022: 31%
Entrez Gene ID: 84968
Uniprot ID: P0CW24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GPWNVVFVPRCSGEEFLGLGRVFHFPEQEGQMVESVAGALGVGLRRVCWLRSIGQAVQPWVEAVRCQSLGVF
• Gene Sequence: GPWNVVFVPRCSGEEFLGLGRVFHFPEQEGQMVESVAGALGVGLRRVCWLRSIGQAVQPWVEAVRCQSLGVF
• Gene ID - Mouse: ENSMUSG00000046287
• Gene ID - Rat: ENSRNOG00000052022
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.