Anti PNMA6A pAb (ATL-HPA045007)

Atlas Antibodies

SKU:
ATL-HPA045007-25
  • Immunohistochemical staining of human oral mucosa shows strong cytoplasmic positivity in squamous epithelial cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: paraneoplastic Ma antigen family member 6A
Gene Name: PNMA6A
Alternative Gene Name: MGC15827, PNMA6C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046287: 31%, ENSRNOG00000052022: 31%
Entrez Gene ID: 84968
Uniprot ID: P0CW24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GPWNVVFVPRCSGEEFLGLGRVFHFPEQEGQMVESVAGALGVGLRRVCWLRSIGQAVQPWVEAVRCQSLGVF
Gene Sequence GPWNVVFVPRCSGEEFLGLGRVFHFPEQEGQMVESVAGALGVGLRRVCWLRSIGQAVQPWVEAVRCQSLGVF
Gene ID - Mouse ENSMUSG00000046287
Gene ID - Rat ENSRNOG00000052022
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PNMA6A pAb (ATL-HPA045007)
Datasheet Anti PNMA6A pAb (ATL-HPA045007) Datasheet (External Link)
Vendor Page Anti PNMA6A pAb (ATL-HPA045007) at Atlas Antibodies

Documents & Links for Anti PNMA6A pAb (ATL-HPA045007)
Datasheet Anti PNMA6A pAb (ATL-HPA045007) Datasheet (External Link)
Vendor Page Anti PNMA6A pAb (ATL-HPA045007)