Anti PMCH pAb (ATL-HPA046055 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA046055-25
  • Immunohistochemical staining of human cerebral cortex, hypothalamus, liver and testis using Anti-PMCH antibody HPA046055 (A) shows similar protein distribution across tissues to independent antibody HPA061884 (B).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: pro-melanin-concentrating hormone
Gene Name: PMCH
Alternative Gene Name: MCH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035383: 81%, ENSRNOG00000004632: 74%
Entrez Gene ID: 5367
Uniprot ID: P20382
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human, Mouse
Clonality Polyclonal
Host Rabbit
Immunogen SIRNLDDDMVFNTFRLGKGFQKEDTAEKSVIAPSLEQYKNDESSFMNEEENKVSKNTGSKHN
Gene Sequence SIRNLDDDMVFNTFRLGKGFQKEDTAEKSVIAPSLEQYKNDESSFMNEEENKVSKNTGSKHN
Gene ID - Mouse ENSMUSG00000035383
Gene ID - Rat ENSRNOG00000004632
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti PMCH pAb (ATL-HPA046055 w/enhanced validation)
Datasheet Anti PMCH pAb (ATL-HPA046055 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PMCH pAb (ATL-HPA046055 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PMCH pAb (ATL-HPA046055 w/enhanced validation)
Datasheet Anti PMCH pAb (ATL-HPA046055 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PMCH pAb (ATL-HPA046055 w/enhanced validation)