Anti PLXNA4 pAb (ATL-HPA029919)

Atlas Antibodies

Catalog No.:
ATL-HPA029919-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: plexin A4
Gene Name: PLXNA4
Alternative Gene Name: DKFZp434G0625PRO34003, FAYV2820, KIAA1550, PLXNA4A, PLXNA4B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029765: 98%, ENSRNOG00000013072: 96%
Entrez Gene ID: 91584
Uniprot ID: Q9HCM2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SHVKVAGVECSPLVDGYIPAEQIVCEMGEAKPSQHAGFVEICVAVCRPEFMARSSQLYYFMTLTLSDLKPSRGPMSGGTQVTI
Gene Sequence SHVKVAGVECSPLVDGYIPAEQIVCEMGEAKPSQHAGFVEICVAVCRPEFMARSSQLYYFMTLTLSDLKPSRGPMSGGTQVTI
Gene ID - Mouse ENSMUSG00000029765
Gene ID - Rat ENSRNOG00000013072
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLXNA4 pAb (ATL-HPA029919)
Datasheet Anti PLXNA4 pAb (ATL-HPA029919) Datasheet (External Link)
Vendor Page Anti PLXNA4 pAb (ATL-HPA029919) at Atlas Antibodies

Documents & Links for Anti PLXNA4 pAb (ATL-HPA029919)
Datasheet Anti PLXNA4 pAb (ATL-HPA029919) Datasheet (External Link)
Vendor Page Anti PLXNA4 pAb (ATL-HPA029919)
Citations for Anti PLXNA4 pAb (ATL-HPA029919) – 1 Found
Toledano, Shira; Sabag, Adi D; Ilan, Neta; Liburkin-Dan, Tanya; Kessler, Ofra; Neufeld, Gera. Plexin-A2 enables the proliferation and the development of tumors from glioblastoma derived cells. Cell Death & Disease. 2023;14(1):41.  PubMed