Anti PLPP6 pAb (ATL-HPA018096)

Atlas Antibodies

Catalog No.: ATL-HPA018096-25

Protein Description: phospholipid phosphatase 6
Gene Name: PLPP6
Alternative Gene Name: FLJ46512, FLJ90191, PDP1, PPAPDC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040105: 88%, ENSRNOG00000015268: 94%
Entrez Gene ID: 403313
Uniprot ID: Q8IY26
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PAHNQMDMFVTLSVDKYSFPSGHATRAALMSR
• Gene Sequence: PAHNQMDMFVTLSVDKYSFPSGHATRAALMSR
• Gene ID - Mouse: ENSMUSG00000040105
• Gene ID - Rat: ENSRNOG00000015268
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.