Anti PLLP pAb (ATL-HPA041862 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA041862-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: plasmolipin
Gene Name: PLLP
Alternative Gene Name: PMLP, TM4SF11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031775: 94%, ENSRNOG00000016558: 91%
Entrez Gene ID: 51090
Uniprot ID: Q9Y342
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAEFPSKVSTRTSSPAQGAEASVSALRPDLGFVRS
Gene Sequence MAEFPSKVSTRTSSPAQGAEASVSALRPDLGFVRS
Gene ID - Mouse ENSMUSG00000031775
Gene ID - Rat ENSRNOG00000016558
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLLP pAb (ATL-HPA041862 w/enhanced validation)
Datasheet Anti PLLP pAb (ATL-HPA041862 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PLLP pAb (ATL-HPA041862 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PLLP pAb (ATL-HPA041862 w/enhanced validation)
Datasheet Anti PLLP pAb (ATL-HPA041862 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PLLP pAb (ATL-HPA041862 w/enhanced validation)