Anti PLK5 pAb (ATL-HPA035024 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA035024-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: polo-like kinase 5
Gene Name: PLK5
Alternative Gene Name: PLK5P, SgK384ps
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035486: 82%, ENSRNOG00000034102: 79%
Entrez Gene ID: 126520
Uniprot ID: Q496M5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YTVLTGTPPFMASPLSEMYQNIREGHYPEPAHLSANARRLIVHLLAPNPAERPSLDHLLQDDFFTQ
Gene Sequence YTVLTGTPPFMASPLSEMYQNIREGHYPEPAHLSANARRLIVHLLAPNPAERPSLDHLLQDDFFTQ
Gene ID - Mouse ENSMUSG00000035486
Gene ID - Rat ENSRNOG00000034102
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLK5 pAb (ATL-HPA035024 w/enhanced validation)
Datasheet Anti PLK5 pAb (ATL-HPA035024 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PLK5 pAb (ATL-HPA035024 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PLK5 pAb (ATL-HPA035024 w/enhanced validation)
Datasheet Anti PLK5 pAb (ATL-HPA035024 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PLK5 pAb (ATL-HPA035024 w/enhanced validation)