Anti PLK5 pAb (ATL-HPA035024 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035024-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PLK5
Alternative Gene Name: PLK5P, SgK384ps
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035486: 82%, ENSRNOG00000034102: 79%
Entrez Gene ID: 126520
Uniprot ID: Q496M5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YTVLTGTPPFMASPLSEMYQNIREGHYPEPAHLSANARRLIVHLLAPNPAERPSLDHLLQDDFFTQ |
| Gene Sequence | YTVLTGTPPFMASPLSEMYQNIREGHYPEPAHLSANARRLIVHLLAPNPAERPSLDHLLQDDFFTQ |
| Gene ID - Mouse | ENSMUSG00000035486 |
| Gene ID - Rat | ENSRNOG00000034102 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PLK5 pAb (ATL-HPA035024 w/enhanced validation) | |
| Datasheet | Anti PLK5 pAb (ATL-HPA035024 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PLK5 pAb (ATL-HPA035024 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti PLK5 pAb (ATL-HPA035024 w/enhanced validation) | |
| Datasheet | Anti PLK5 pAb (ATL-HPA035024 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PLK5 pAb (ATL-HPA035024 w/enhanced validation) |