Anti PLEKHH1 pAb (ATL-HPA047707)

Atlas Antibodies

SKU: ATL-HPA047707-25

• 
• 

Protein Description: pleckstrin homology domain containing, family H (with MyTH4 domain) member 1
Gene Name: PLEKHH1
Alternative Gene Name: KIAA1200
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060716: 66%, ENSRNOG00000010650: 66%
Entrez Gene ID: 57475
Uniprot ID: Q9ULM0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSSTVHSGETVEAKPLQPHLGRESPPHQPCMKLLTFRCSSASWGEGLVTAQRGMLPGTKTSAREGGPGSSLTLPKV
• Gene Sequence: SSSTVHSGETVEAKPLQPHLGRESPPHQPCMKLLTFRCSSASWGEGLVTAQRGMLPGTKTSAREGGPGSSLTLPKV
• Gene ID - Mouse: ENSMUSG00000060716
• Gene ID - Rat: ENSRNOG00000010650
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.