Anti PLD6 pAb (ATL-HPA049345)

Atlas Antibodies

Catalog No.:
ATL-HPA049345-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: phospholipase D family, member 6
Gene Name: PLD6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043648: 61%, ENSRNOG00000021657: 61%
Entrez Gene ID: 201164
Uniprot ID: Q8N2A8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QDPGYMHHKFAIVDKRVLITGSLNWTTQAIQNNRENVLITEDDEYVRLFLEEFERIWEQFNPTKYTFFPPKKSHGSCAPPVSRAGGRLLSWHRTCGTSSESQT
Gene Sequence QDPGYMHHKFAIVDKRVLITGSLNWTTQAIQNNRENVLITEDDEYVRLFLEEFERIWEQFNPTKYTFFPPKKSHGSCAPPVSRAGGRLLSWHRTCGTSSESQT
Gene ID - Mouse ENSMUSG00000043648
Gene ID - Rat ENSRNOG00000021657
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLD6 pAb (ATL-HPA049345)
Datasheet Anti PLD6 pAb (ATL-HPA049345) Datasheet (External Link)
Vendor Page Anti PLD6 pAb (ATL-HPA049345) at Atlas Antibodies

Documents & Links for Anti PLD6 pAb (ATL-HPA049345)
Datasheet Anti PLD6 pAb (ATL-HPA049345) Datasheet (External Link)
Vendor Page Anti PLD6 pAb (ATL-HPA049345)