Anti PLD5 pAb (ATL-HPA028389)

Atlas Antibodies

Catalog No.: ATL-HPA028389-25

Protein Description: phospholipase D family, member 5
Gene Name: PLD5
Alternative Gene Name: FLJ40773
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055214: 78%, ENSRNOG00000003997: 79%
Entrez Gene ID: 200150
Uniprot ID: Q8N7P1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DWVGNDFTQNAGTGLVINQADVRNNRSIIKQLKDVFERDWYSPYAKTLQPTKQPNCSSLFKLKPLSNKTATDDTGGKDPRNV
• Gene Sequence: DWVGNDFTQNAGTGLVINQADVRNNRSIIKQLKDVFERDWYSPYAKTLQPTKQPNCSSLFKLKPLSNKTATDDTGGKDPRNV
• Gene ID - Mouse: ENSMUSG00000055214
• Gene ID - Rat: ENSRNOG00000003997
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.