Anti PLCL2 pAb (ATL-HPA047616)

Atlas Antibodies

Catalog No.:
ATL-HPA047616-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: phospholipase C-like 2
Gene Name: PLCL2
Alternative Gene Name: KIAA1092, PLCE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038910: 95%, ENSRNOG00000013368: 93%
Entrez Gene ID: 23228
Uniprot ID: Q9UPR0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DMLESSQDNMRTSWVSQMFSEIDVDNLGHITLCNAVQCIRNLNPGLKTSKIELKFKELHKSKDKAGTEVTKEEFIE
Gene Sequence DMLESSQDNMRTSWVSQMFSEIDVDNLGHITLCNAVQCIRNLNPGLKTSKIELKFKELHKSKDKAGTEVTKEEFIE
Gene ID - Mouse ENSMUSG00000038910
Gene ID - Rat ENSRNOG00000013368
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLCL2 pAb (ATL-HPA047616)
Datasheet Anti PLCL2 pAb (ATL-HPA047616) Datasheet (External Link)
Vendor Page Anti PLCL2 pAb (ATL-HPA047616) at Atlas Antibodies

Documents & Links for Anti PLCL2 pAb (ATL-HPA047616)
Datasheet Anti PLCL2 pAb (ATL-HPA047616) Datasheet (External Link)
Vendor Page Anti PLCL2 pAb (ATL-HPA047616)