Anti PLCD1 pAb (ATL-HPA020107)

Atlas Antibodies

Catalog No.: ATL-HPA020107-25

Protein Description: phospholipase C, delta 1
Gene Name: PLCD1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010660: 90%, ENSRNOG00000032238: 90%
Entrez Gene ID: 5333
Uniprot ID: P51178
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EAFYKMLTQRVEIDRTFAEAAGSGETLSVDQLVTFLQHQQREEAAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSADGSAFSLAHRRVYQDMGQP
• Gene Sequence: EAFYKMLTQRVEIDRTFAEAAGSGETLSVDQLVTFLQHQQREEAAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSADGSAFSLAHRRVYQDMGQP
• Gene ID - Mouse: ENSMUSG00000010660
• Gene ID - Rat: ENSRNOG00000032238
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PLCD1 pAb (ATL-HPA020107) – 1 Found

Kiuru, Maija; Kurban, Mazen; Itoh, Munenari; Petukhova, Lynn; Shimomura, Yutaka; Wajid, Muhammad; Christiano, Angela M. Hereditary leukonychia, or porcelain nails, resulting from mutations in PLCD1. American Journal Of Human Genetics. 2011;88(6):839-844.