Anti PLCD1 pAb (ATL-HPA020107)

Atlas Antibodies

Catalog No.:
ATL-HPA020107-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: phospholipase C, delta 1
Gene Name: PLCD1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010660: 90%, ENSRNOG00000032238: 90%
Entrez Gene ID: 5333
Uniprot ID: P51178
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EAFYKMLTQRVEIDRTFAEAAGSGETLSVDQLVTFLQHQQREEAAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSADGSAFSLAHRRVYQDMGQP
Gene Sequence EAFYKMLTQRVEIDRTFAEAAGSGETLSVDQLVTFLQHQQREEAAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSADGSAFSLAHRRVYQDMGQP
Gene ID - Mouse ENSMUSG00000010660
Gene ID - Rat ENSRNOG00000032238
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLCD1 pAb (ATL-HPA020107)
Datasheet Anti PLCD1 pAb (ATL-HPA020107) Datasheet (External Link)
Vendor Page Anti PLCD1 pAb (ATL-HPA020107) at Atlas Antibodies

Documents & Links for Anti PLCD1 pAb (ATL-HPA020107)
Datasheet Anti PLCD1 pAb (ATL-HPA020107) Datasheet (External Link)
Vendor Page Anti PLCD1 pAb (ATL-HPA020107)
Citations for Anti PLCD1 pAb (ATL-HPA020107) – 1 Found
Kiuru, Maija; Kurban, Mazen; Itoh, Munenari; Petukhova, Lynn; Shimomura, Yutaka; Wajid, Muhammad; Christiano, Angela M. Hereditary leukonychia, or porcelain nails, resulting from mutations in PLCD1. American Journal Of Human Genetics. 2011;88(6):839-844.  PubMed