Anti PLA2R1 pAb (ATL-HPA012657 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA012657-25

Protein Description: phospholipase A2 receptor 1, 180kDa
Gene Name: PLA2R1
Alternative Gene Name: CLEC13C, PLA2-R, PLA2G1R, PLA2IR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054580: 74%, ENSRNOG00000008129: 76%
Entrez Gene ID: 22925
Uniprot ID: Q13018
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID
• Gene Sequence: EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID
• Gene ID - Mouse: ENSMUSG00000054580
• Gene ID - Rat: ENSRNOG00000008129
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PLA2R1 pAb (ATL-HPA012657 w/enhanced validation) – 19 Found

Akiyama, Shin'ichi; Akiyama, Mari; Imai, Enyu; Ozaki, Takenori; Matsuo, Seiichi; Maruyama, Shoichi. Prevalence of anti-phospholipase A2 receptor antibodies in Japanese patients with membranous nephropathy. Clinical And Experimental Nephrology. 2015;19(4):653-60. 

Wang, Jia; Xie, Qionghong; Sun, Zhuxing; Xu, Ningxin; Li, Yan; Wang, Liang; Liu, Shaojun; Xue, Jun; Hao, Chuan-Ming. Response to immunosuppressive therapy in PLA(2)R- associated and non-PLA(2)R- associated idiopathic membranous nephropathy: a retrospective, multicenter cohort study. Bmc Nephrology. 2017;18(1):227. 

Zhang, Qiuhua; Huang, Biao; Liu, Xiaobin; Liu, Bin; Zhang, Yi; Zhang, Zhijian; Hua, Jia; Fan, Yun; Hu, Ling; Meng, Meijuan; Wu, Mian; Wang, Liang; Hu, Zhigang; Sun, Zhuxing. Ultrasensitive Quantitation of Anti-Phospholipase A2 Receptor Antibody as A Diagnostic and Prognostic Indicator of Idiopathic Membranous Nephropathy. Scientific Reports. 2017;7(1):12049. 

Caza, Tiffany N; Hassen, Samar I; Dvanajscak, Zeljko; Kuperman, Michael; Edmondson, Rick; Herzog, Christian; Storey, Aaron; Arthur, John; Cossey, L Nicholas; Sharma, Shree G; Kenan, Daniel J; Larsen, Christopher P. NELL1 is a target antigen in malignancy-associated membranous nephropathy. Kidney International. 2021;99(4):967-976. 

Caza, Tiffany N; Hassen, Samar I; Kuperman, Michael; Sharma, Shree G; Dvanajscak, Zeljko; Arthur, John; Edmondson, Rick; Storey, Aaron; Herzog, Christian; Kenan, Daniel J; Larsen, Christopher P. Neural cell adhesion molecule 1 is a novel autoantigen in membranous lupus nephritis. Kidney International. 2021;100(1):171-181. 

Li, Yanfen; Yu, Juntao; Wang, Miao; Cui, Zhao; Zhao, Ming-Hui. Anti-phospholipase A2 receptor antibodies directly induced podocyte damage in vitro. Renal Failure. 2022;44(1):304-313. 

Debiec, Hanna; Ronco, Pierre. PLA2R autoantibodies and PLA2R glomerular deposits in membranous nephropathy. The New England Journal Of Medicine. 2011;364(7):689-90. 

Debiec, H; Martin, L; Jouanneau, C; Dautin, G; Mesnard, L; Rondeau, E; Mousson, C; Ronco, P. Autoantibodies specific for the phospholipase A2 receptor in recurrent and De Novo membranous nephropathy. American Journal Of Transplantation : Official Journal Of The American Society Of Transplantation And The American Society Of Transplant Surgeons. 2011;11(10):2144-52. 

Hoxha, Elion; Kneißler, Ursula; Stege, Gesa; Zahner, Gunther; Thiele, Ina; Panzer, Ulf; Harendza, Sigrid; Helmchen, Udo M; Stahl, Rolf A K. Enhanced expression of the M-type phospholipase A2 receptor in glomeruli correlates with serum receptor antibodies in primary membranous nephropathy. Kidney International. 2012;82(7):797-804. 

Svobodova, Barbora; Honsova, Eva; Ronco, Pierre; Tesar, Vladimir; Debiec, Hanna. Kidney biopsy is a sensitive tool for retrospective diagnosis of PLA2R-related membranous nephropathy. Nephrology, Dialysis, Transplantation : Official Publication Of The European Dialysis And Transplant Association - European Renal Association. 2013;28(7):1839-44. 

Augert, Arnaud; Vindrieux, David; Girard, Christophe A; Le Calvé, Benjamin; Gras, Baptiste; Ferrand, Mylène; Bouchet, Benjamin P; Puisieux, Alain; de Launoit, Yvan; Simonnet, Hélène; Lambeau, Gérard; Bernard, David. PLA2R1 kills cancer cells by inducing mitochondrial stress. Free Radical Biology & Medicine. 2013;65( 23994771):969-977. 

Dauvergne, Maxime; Moktefi, Anissa; Rabant, Marion; Vigneau, Cécile; Kofman, Tomek; Burtey, Stephane; Corpechot, Christophe; Stehlé, Thomas; Desvaux, Dominique; Rioux-Leclercq, Nathalie; Rouvier, Philippe; Knebelmann, Bertrand; Boffa, Jean-Jacques; Frouget, Thierry; Daugas, Eric; Jablonski, Mathieu; Dahan, Karine; Brocheriou, Isabelle; Remy, Philippe; Grimbert, Philippe; Lang, Philippe; Chazouilleres, Oliver; Sahali, Dil; Audard, Vincent. Membranous Nephropathy Associated With Immunological Disorder-Related Liver Disease: A Retrospective Study of 10 Cases. Medicine. 2015;94(30):e1243. 

Iwakura, Takamasa; Ohashi, Naro; Kato, Akihiko; Baba, Satoshi; Yasuda, Hideo. Prevalence of Enhanced Granular Expression of Thrombospondin Type-1 Domain-Containing 7A in the Glomeruli of Japanese Patients with Idiopathic Membranous Nephropathy. Plos One. 10(9):e0138841. 

Charu, Vivek; Andeen, Nicole; Walavalkar, Vighnesh; Lapasia, Jessica; Kim, Jin-Yon; Lin, Andrew; Sibley, Richard; Higgins, John; Troxell, Megan; Kambham, Neeraja. Membranous nephropathy in patients with HIV: a report of 11 cases. Bmc Nephrology. 2020;21(1):401. 

Al-Rabadi, Laith Farah; Caza, Tiffany; Trivin-Avillach, Claire; Rodan, Aylin R; Andeen, Nicole; Hayashi, Norifumi; Williams, Brandi; Revelo, Monica P; Clayton, Fred; Abraham, Jo; Lin, Edwin; Liou, Willisa; Zou, Chang-Jiang; Ramkumar, Nirupama; Cummins, Tim; Wilkey, Daniel W; Kawalit, Issa; Herzog, Christian; Storey, Aaron; Edmondson, Rick; Sjoberg, Ronald; Yang, Tianxin; Chien, Jeremy; Merchant, Michael; Arthur, John; Klein, Jon; Larsen, Chris; Beck, Laurence H Jr. Serine Protease HTRA1 as a Novel Target Antigen in Primary Membranous Nephropathy. Journal Of The American Society Of Nephrology : Jasn. 2021;32(7):1666-1681. 

Caza, Tiffany N; Hassen, Samar I; Larsen, Christopher P. Renal Manifestations of Common Variable Immunodeficiency. Kidney360. 2020;1(6):491-500. 

Caza, Tiffany N; Hassen, Samar I; Kenan, Daniel J; Storey, Aaron; Arthur, John M; Herzog, Christian; Edmondson, Rick D; Bourne, T David; Beck, Laurence H Jr; Larsen, Christopher P. Transforming Growth Factor Beta Receptor 3 (TGFBR3)-Associated Membranous Nephropathy. Kidney360. 2021;2(8):1275-1286. 

Teisseyre, Maxime; Beyze, Anaïs; Perrochia, Hélène; Szwarc, Ilan; Bourgeois, Alexis; Champion, Coralie; Chenine, Leila; Serre, Jean-Emmanuel; Broner, Jonathan; Aglae, Cédric; Pernin, Vincent; Le Quintrec, Moglie. C5b-9 Glomerular Deposits Are Associated With Poor Renal Survival in Membranous Nephropathy. Kidney International Reports. 2023;8(1):103-114. 

Matsumoto, Ayumi; Matsui, Isao; Mano, Keiji; Mizuno, Hitoshi; Katsuma, Yusuke; Yasuda, Seiichi; Shimada, Karin; Inoue, Kazunori; Oki, Takashi; Hanai, Tadashi; Kojima, Keiko; Kaneko, Tetsuya; Isaka, Yoshitaka. Recurrent membranous nephropathy with a possible alteration in the etiology: a case report. Bmc Nephrology. 2021;22(1):253.