Anti PLA2G2E pAb (ATL-HPA064085)

Atlas Antibodies

Catalog No.:
ATL-HPA064085-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: phospholipase A2, group IIE
Gene Name: PLA2G2E
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028751: 90%, ENSRNOG00000016838: 56%
Entrez Gene ID: 30814
Uniprot ID: Q9NZK7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GNLVQFGVMIEKMTGKSALQYNDYGCYCGIG
Gene Sequence GNLVQFGVMIEKMTGKSALQYNDYGCYCGIG
Gene ID - Mouse ENSMUSG00000028751
Gene ID - Rat ENSRNOG00000016838
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLA2G2E pAb (ATL-HPA064085)
Datasheet Anti PLA2G2E pAb (ATL-HPA064085) Datasheet (External Link)
Vendor Page Anti PLA2G2E pAb (ATL-HPA064085) at Atlas Antibodies

Documents & Links for Anti PLA2G2E pAb (ATL-HPA064085)
Datasheet Anti PLA2G2E pAb (ATL-HPA064085) Datasheet (External Link)
Vendor Page Anti PLA2G2E pAb (ATL-HPA064085)