Anti PLA2G12A pAb (ATL-HPA035909)

Atlas Antibodies

Catalog No.:
ATL-HPA035909-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: phospholipase A2, group XIIA
Gene Name: PLA2G12A
Alternative Gene Name: PLA2G12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027999: 95%, ENSRNOG00000057470: 93%
Entrez Gene ID: 81579
Uniprot ID: Q9BZM1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHY
Gene Sequence IGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHY
Gene ID - Mouse ENSMUSG00000027999
Gene ID - Rat ENSRNOG00000057470
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PLA2G12A pAb (ATL-HPA035909)
Datasheet Anti PLA2G12A pAb (ATL-HPA035909) Datasheet (External Link)
Vendor Page Anti PLA2G12A pAb (ATL-HPA035909) at Atlas Antibodies

Documents & Links for Anti PLA2G12A pAb (ATL-HPA035909)
Datasheet Anti PLA2G12A pAb (ATL-HPA035909) Datasheet (External Link)
Vendor Page Anti PLA2G12A pAb (ATL-HPA035909)