Anti PLA2G12A pAb (ATL-HPA035909)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035909-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: PLA2G12A
Alternative Gene Name: PLA2G12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027999: 95%, ENSRNOG00000057470: 93%
Entrez Gene ID: 81579
Uniprot ID: Q9BZM1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHY |
| Gene Sequence | IGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHY |
| Gene ID - Mouse | ENSMUSG00000027999 |
| Gene ID - Rat | ENSRNOG00000057470 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PLA2G12A pAb (ATL-HPA035909) | |
| Datasheet | Anti PLA2G12A pAb (ATL-HPA035909) Datasheet (External Link) |
| Vendor Page | Anti PLA2G12A pAb (ATL-HPA035909) at Atlas Antibodies |
| Documents & Links for Anti PLA2G12A pAb (ATL-HPA035909) | |
| Datasheet | Anti PLA2G12A pAb (ATL-HPA035909) Datasheet (External Link) |
| Vendor Page | Anti PLA2G12A pAb (ATL-HPA035909) |