Anti PKP1 pAb (ATL-HPA027221 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA027221-25

Protein Description: plakophilin 1
Gene Name: PKP1
Alternative Gene Name: B6P
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026413: 84%, ENSRNOG00000013728: 26%
Entrez Gene ID: 5317
Uniprot ID: Q13835
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YTVRNLMASQPQLAKQYFSSSMLNNIINLCRSSASPKAAEAARLLLSDMWSSKELQGVLRQQGFDRNMLGTLAGANSLRNFTSRF
• Gene Sequence: YTVRNLMASQPQLAKQYFSSSMLNNIINLCRSSASPKAAEAARLLLSDMWSSKELQGVLRQQGFDRNMLGTLAGANSLRNFTSRF
• Gene ID - Mouse: ENSMUSG00000026413
• Gene ID - Rat: ENSRNOG00000013728
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PKP1 pAb (ATL-HPA027221 w/enhanced validation) – 3 Found

Kaz, Andrew M; Luo, Yanxin; Dzieciatkowski, Slavomir; Chak, Amitabh; Willis, Joseph E; Upton, Melissa P; Leidner, Rom S; Grady, William M. Aberrantly methylated PKP1 in the progression of Barrett's esophagus to esophageal adenocarcinoma. Genes, Chromosomes & Cancer. 2012;51(4):384-93. 

Galindo, Inmaculada; Gómez-Morales, Mercedes; Díaz-Cano, Inés; Andrades, Álvaro; Caba-Molina, Mercedes; Miranda-León, María Teresa; Medina, Pedro Pablo; Martín-Padron, Joel; Fárez-Vidal, María Esther. The value of desmosomal plaque-related markers to distinguish squamous cell carcinoma and adenocarcinoma of the lung. Upsala Journal Of Medical Sciences. 2020;125(1):19-29. 

Pan, Li; Lemieux, Madeleine E; Thomas, Tom; Rogers, Julia M; Lipper, Colin H; Lee, Winston; Johnson, Carl; Sholl, Lynette M; South, Andrew P; Marto, Jarrod A; Adelmant, Guillaume O; Blacklow, Stephen C; Aster, Jon C. IER5, a DNA damage response gene, is required for Notch-mediated induction of squamous cell differentiation. Elife. 2020;9( 32936072)