Anti PKM pAb (ATL-HPA029501 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA029501-100

Protein Description: pyruvate kinase, muscle
Gene Name: PKM
Alternative Gene Name: OIP3, PK3, PKM2, THBP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032294: 98%, ENSRNOG00000011329: 97%
Entrez Gene ID: 5315
Uniprot ID: P14618
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSL
• Gene Sequence: TATESFASDPILYRPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSL
• Gene ID - Mouse: ENSMUSG00000032294
• Gene ID - Rat: ENSRNOG00000011329
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PKM pAb (ATL-HPA029501 w/enhanced validation) – 4 Found

Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300. 

Röwer, Claudia; Ziems, Björn; Radtke, Anngret; Schmitt, Oliver; Reimer, Toralf; Koy, Cornelia; Thiesen, Hans-Jürgen; Gerber, Bernd; Glocker, Michael O. Toponostics of invasive ductal breast carcinoma: combination of spatial protein expression imaging and quantitative proteome signature analysis. International Journal Of Clinical And Experimental Pathology. 2011;4(5):454-67. 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Ludvigsen, Maja; Thorlacius-Ussing, Louise; Vorum, Henrik; Stender, Mogens Tornby; Thorlacius-Ussing, Ole; Honoré, Bent. Proteomic Characterization of Colorectal Cancer Tissue from Patients Identifies Novel Putative Protein Biomarkers. Current Issues In Molecular Biology. 2021;43(2):1043-1056.