Anti PKLR pAb (ATL-HPA006653)

Atlas Antibodies

Catalog No.: ATL-HPA006653-25

Protein Description: pyruvate kinase, liver and RBC
Gene Name: PKLR
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041237: 86%, ENSRNOG00000020420: 87%
Entrez Gene ID: 5313
Uniprot ID: P30613
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GSPLSYRPVAIALDTKGPEIRTGILQGGPESEVELVKGSQVLVTVDPAFRTRGNANTVWVDYPNIVRVVPVGGRIYIDDGLISLVVQKIGPEGLVTQVENGGVLGSRKGVNLPGA
• Gene Sequence: GSPLSYRPVAIALDTKGPEIRTGILQGGPESEVELVKGSQVLVTVDPAFRTRGNANTVWVDYPNIVRVVPVGGRIYIDDGLISLVVQKIGPEGLVTQVENGGVLGSRKGVNLPGA
• Gene ID - Mouse: ENSMUSG00000041237
• Gene ID - Rat: ENSRNOG00000020420
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PKLR pAb (ATL-HPA006653) – 1 Found

Niinivirta, Marjut; Enblad, Gunilla; Lindskog, Cecilia; Pontén, Fredrik; Dragomir, Anca; Ullenhag, Gustav J. Tumoral Pyruvate Kinase L/R as a Predictive Marker for the Treatment of Renal Cancer Patients with Sunitinib and Sorafenib. Journal Of Cancer. 10(14):3224-3231.