Anti PKD2 pAb (ATL-HPA015794)

Atlas Antibodies

Catalog No.:
ATL-HPA015794-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: polycystic kidney disease 2 (autosomal dominant)
Gene Name: PKD2
Alternative Gene Name: Pc-2, PC2, PKD4, TRPP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034462: 96%, ENSRNOG00000002146: 96%
Entrez Gene ID: 5311
Uniprot ID: Q13563
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen REDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRDSEIHREQMERLVREELERWESDDAASQISH
Gene Sequence REDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRDSEIHREQMERLVREELERWESDDAASQISH
Gene ID - Mouse ENSMUSG00000034462
Gene ID - Rat ENSRNOG00000002146
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PKD2 pAb (ATL-HPA015794)
Datasheet Anti PKD2 pAb (ATL-HPA015794) Datasheet (External Link)
Vendor Page Anti PKD2 pAb (ATL-HPA015794) at Atlas Antibodies

Documents & Links for Anti PKD2 pAb (ATL-HPA015794)
Datasheet Anti PKD2 pAb (ATL-HPA015794) Datasheet (External Link)
Vendor Page Anti PKD2 pAb (ATL-HPA015794)