Anti PITX1 pAb (ATL-HPA008743)

Atlas Antibodies

Catalog No.: ATL-HPA008743-25

Protein Description: paired-like homeodomain 1
Gene Name: PITX1
Alternative Gene Name: BFT, POTX, PTX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021506: 100%, ENSRNOG00000011423: 99%
Entrez Gene ID: 5307
Uniprot ID: P78337
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSS
• Gene Sequence: SFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSS
• Gene ID - Mouse: ENSMUSG00000021506
• Gene ID - Rat: ENSRNOG00000011423
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PITX1 pAb (ATL-HPA008743) – 3 Found

Otsubo, Takeshi; Yamada, Kazuhiko; Hagiwara, Teruki; Oshima, Kenshiro; Iida, Kei; Nishikata, Koro; Toyoda, Tetsuro; Igari, Toru; Nohara, Kyoko; Yamashita, Satoshi; Hattori, Masahira; Dohi, Taeko; Kawamura, Yuki I. DNA hypermethyation and silencing of PITX1 correlated with advanced stage and poor postoperative prognosis of esophageal squamous cell carcinoma. Oncotarget. 2017;8(48):84434-84448. 

Chen, Ying; Xu, Hanqian; Lin, Gufa. Generation of iPSC-derived limb progenitor-like cells for stimulating phalange regeneration in the adult mouse. Cell Discovery. 3( 29263795):17046. 

Poos, Alexandra M; Schroeder, Cornelia; Jaishankar, Neeraja; Röll, Daniela; Oswald, Marcus; Meiners, Jan; Braun, Delia M; Knotz, Caroline; Frank, Lukas; Gunkel, Manuel; Spilger, Roman; Wollmann, Thomas; Polonski, Adam; Makrypidi-Fraune, Georgia; Fraune, Christoph; Graefen, Markus; Chung, Inn; Stenzel, Alexander; Erfle, Holger; Rohr, Karl; Baniahmad, Aria; Sauter, Guido; Rippe, Karsten; Simon, Ronald; Koenig, Rainer. PITX1 Is a Regulator of TERT Expression in Prostate Cancer with Prognostic Power. Cancers. 2022;14(5)