Anti PINX1 pAb (ATL-HPA023146)

Atlas Antibodies

Catalog No.: ATL-HPA023146-25

Protein Description: PIN2/TERF1 interacting telomerase inhibitor 1
Gene Name: PINX1
Alternative Gene Name: FLJ20565, Gno1, LPTL, LPTS, MGC8850, PinX1, Pxr1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021958: 70%, ENSRNOG00000012012: 63%
Entrez Gene ID: 54984
Uniprot ID: Q96BK5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ENETTTTSAFTIQEYFAKRMAALKNKPQVPVPGSDISETQVERKRGKKRNKEATGKDVESYLQP
• Gene Sequence: ENETTTTSAFTIQEYFAKRMAALKNKPQVPVPGSDISETQVERKRGKKRNKEATGKDVESYLQP
• Gene ID - Mouse: ENSMUSG00000021958
• Gene ID - Rat: ENSRNOG00000012012
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.