Anti PINX1 pAb (ATL-HPA023139)

Atlas Antibodies

Catalog No.:
ATL-HPA023139-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: PIN2/TERF1 interacting, telomerase inhibitor 1
Gene Name: PINX1
Alternative Gene Name: FLJ20565, LPTL, LPTS, MGC8850, PinX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021958: 83%, ENSRNOG00000012012: 83%
Entrez Gene ID: 54984
Uniprot ID: Q96BK5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LNTCHGQETTDSSDKKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTPEGDASPSTP
Gene Sequence LNTCHGQETTDSSDKKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTPEGDASPSTP
Gene ID - Mouse ENSMUSG00000021958
Gene ID - Rat ENSRNOG00000012012
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PINX1 pAb (ATL-HPA023139)
Datasheet Anti PINX1 pAb (ATL-HPA023139) Datasheet (External Link)
Vendor Page Anti PINX1 pAb (ATL-HPA023139) at Atlas Antibodies

Documents & Links for Anti PINX1 pAb (ATL-HPA023139)
Datasheet Anti PINX1 pAb (ATL-HPA023139) Datasheet (External Link)
Vendor Page Anti PINX1 pAb (ATL-HPA023139)