Anti PIK3C2B pAb (ATL-HPA050360)

Atlas Antibodies

Catalog No.:
ATL-HPA050360-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 beta
Gene Name: PIK3C2B
Alternative Gene Name: C2-PI3K, PI3K-C2beta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026447: 92%, ENSRNOG00000029938: 90%
Entrez Gene ID: 5287
Uniprot ID: O00750
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PHTVANGHELFEVSEERDEEVAAFCHMLDILRSGSDIQDYFLTGYVWSAVTPSPEHLGDEVNLKVTVLCDRLQEALTFTCNCSSTVDLLIYQTLCY
Gene Sequence PHTVANGHELFEVSEERDEEVAAFCHMLDILRSGSDIQDYFLTGYVWSAVTPSPEHLGDEVNLKVTVLCDRLQEALTFTCNCSSTVDLLIYQTLCY
Gene ID - Mouse ENSMUSG00000026447
Gene ID - Rat ENSRNOG00000029938
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PIK3C2B pAb (ATL-HPA050360)
Datasheet Anti PIK3C2B pAb (ATL-HPA050360) Datasheet (External Link)
Vendor Page Anti PIK3C2B pAb (ATL-HPA050360) at Atlas Antibodies

Documents & Links for Anti PIK3C2B pAb (ATL-HPA050360)
Datasheet Anti PIK3C2B pAb (ATL-HPA050360) Datasheet (External Link)
Vendor Page Anti PIK3C2B pAb (ATL-HPA050360)