Anti PIK3C2B pAb (ATL-HPA050360)

Atlas Antibodies

Catalog No.: ATL-HPA050360-25

Protein Description: phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 beta
Gene Name: PIK3C2B
Alternative Gene Name: C2-PI3K, PI3K-C2beta
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026447: 92%, ENSRNOG00000029938: 90%
Entrez Gene ID: 5287
Uniprot ID: O00750
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PHTVANGHELFEVSEERDEEVAAFCHMLDILRSGSDIQDYFLTGYVWSAVTPSPEHLGDEVNLKVTVLCDRLQEALTFTCNCSSTVDLLIYQTLCY
• Gene Sequence: PHTVANGHELFEVSEERDEEVAAFCHMLDILRSGSDIQDYFLTGYVWSAVTPSPEHLGDEVNLKVTVLCDRLQEALTFTCNCSSTVDLLIYQTLCY
• Gene ID - Mouse: ENSMUSG00000026447
• Gene ID - Rat: ENSRNOG00000029938
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.