Anti PIGU pAb (ATL-HPA046766)

Atlas Antibodies

Catalog No.:
ATL-HPA046766-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: phosphatidylinositol glycan anchor biosynthesis, class U
Gene Name: PIGU
Alternative Gene Name: bA346K17.2, CDC91L1, GAB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038383: 98%, ENSRNOG00000025181: 87%
Entrez Gene ID: 128869
Uniprot ID: Q9H490
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LAEFISERVEVVSPLSSWKRVVEGLSLLDLGVSPYSGAVFHETPL
Gene Sequence LAEFISERVEVVSPLSSWKRVVEGLSLLDLGVSPYSGAVFHETPL
Gene ID - Mouse ENSMUSG00000038383
Gene ID - Rat ENSRNOG00000025181
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PIGU pAb (ATL-HPA046766)
Datasheet Anti PIGU pAb (ATL-HPA046766) Datasheet (External Link)
Vendor Page Anti PIGU pAb (ATL-HPA046766) at Atlas Antibodies

Documents & Links for Anti PIGU pAb (ATL-HPA046766)
Datasheet Anti PIGU pAb (ATL-HPA046766) Datasheet (External Link)
Vendor Page Anti PIGU pAb (ATL-HPA046766)