Anti PIGU pAb (ATL-HPA046766)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046766-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PIGU
Alternative Gene Name: bA346K17.2, CDC91L1, GAB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038383: 98%, ENSRNOG00000025181: 87%
Entrez Gene ID: 128869
Uniprot ID: Q9H490
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LAEFISERVEVVSPLSSWKRVVEGLSLLDLGVSPYSGAVFHETPL |
| Gene Sequence | LAEFISERVEVVSPLSSWKRVVEGLSLLDLGVSPYSGAVFHETPL |
| Gene ID - Mouse | ENSMUSG00000038383 |
| Gene ID - Rat | ENSRNOG00000025181 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PIGU pAb (ATL-HPA046766) | |
| Datasheet | Anti PIGU pAb (ATL-HPA046766) Datasheet (External Link) |
| Vendor Page | Anti PIGU pAb (ATL-HPA046766) at Atlas Antibodies |
| Documents & Links for Anti PIGU pAb (ATL-HPA046766) | |
| Datasheet | Anti PIGU pAb (ATL-HPA046766) Datasheet (External Link) |
| Vendor Page | Anti PIGU pAb (ATL-HPA046766) |