Anti PIGR pAb (ATL-HPA012012 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA012012-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: PIGR
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026417: 65%, ENSRNOG00000004405: 67%
Entrez Gene ID: 5284
Uniprot ID: P01833
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LLFSVVINQLRLSDAGQYLCQAGDDSNSNKKNADLQVLKPEPELVYEDLRGSVTFHCALGPEVANVAKFLCRQSSGENCDVVVNTLGKRAPAFEGRILLNPQDKDGSFSVVITGLRKEDAGRYLCGAHS |
| Gene Sequence | LLFSVVINQLRLSDAGQYLCQAGDDSNSNKKNADLQVLKPEPELVYEDLRGSVTFHCALGPEVANVAKFLCRQSSGENCDVVVNTLGKRAPAFEGRILLNPQDKDGSFSVVITGLRKEDAGRYLCGAHS |
| Gene ID - Mouse | ENSMUSG00000026417 |
| Gene ID - Rat | ENSRNOG00000004405 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PIGR pAb (ATL-HPA012012 w/enhanced validation) | |
| Datasheet | Anti PIGR pAb (ATL-HPA012012 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PIGR pAb (ATL-HPA012012 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti PIGR pAb (ATL-HPA012012 w/enhanced validation) | |
| Datasheet | Anti PIGR pAb (ATL-HPA012012 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PIGR pAb (ATL-HPA012012 w/enhanced validation) |
| Citations for Anti PIGR pAb (ATL-HPA012012 w/enhanced validation) – 5 Found |
| Trevisi, Paolo; Gandolfi, Greta; Priori, Davide; Messori, Stefano; Colombo, Michela; Mazzoni, Maurizio; Lallès, Jean-Paul; Bosi, Paolo. Age-related expression of the polymeric immunoglobulin receptor (pIgR) in the gastric mucosa of young pigs. Plos One. 8(11):e81473. PubMed |
| Berntsson, Jonna; Lundgren, Sebastian; Nodin, Björn; Uhlén, Mathias; Gaber, Alexander; Jirström, Karin. Expression and prognostic significance of the polymeric immunoglobulin receptor in epithelial ovarian cancer. Journal Of Ovarian Research. 2014;7( 24568264):26. PubMed |
| Fristedt, Richard; Gaber, Alexander; Hedner, Charlotta; Nodin, Björn; Uhlén, Mathias; Eberhard, Jakob; Jirström, Karin. Expression and prognostic significance of the polymeric immunoglobulin receptor in esophageal and gastric adenocarcinoma. Journal Of Translational Medicine. 2014;12( 24694107):83. PubMed |
| Fristedt, Richard; Elebro, Jacob; Gaber, Alexander; Jonsson, Liv; Heby, Margareta; Yudina, Yulyana; Nodin, Björn; Uhlén, Mathias; Eberhard, Jakob; Jirström, Karin. Reduced expression of the polymeric immunoglobulin receptor in pancreatic and periampullary adenocarcinoma signifies tumour progression and poor prognosis. Plos One. 9(11):e112728. PubMed |
| Rostami, Mahboubeh R; LeBlanc, Michelle G; Strulovici-Barel, Yael; Zuo, Wulin; Mezey, Jason G; O'Beirne, Sarah L; Kaner, Robert J; Leopold, Philip L; Crystal, Ronald G. Smoking shifts human small airway epithelium club cells toward a lesser differentiated population. Npj Genomic Medicine. 2021;6(1):73. PubMed |