Anti PIGR pAb (ATL-HPA012012 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA012012-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: polymeric immunoglobulin receptor
Gene Name: PIGR
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026417: 65%, ENSRNOG00000004405: 67%
Entrez Gene ID: 5284
Uniprot ID: P01833
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLFSVVINQLRLSDAGQYLCQAGDDSNSNKKNADLQVLKPEPELVYEDLRGSVTFHCALGPEVANVAKFLCRQSSGENCDVVVNTLGKRAPAFEGRILLNPQDKDGSFSVVITGLRKEDAGRYLCGAHS
Gene Sequence LLFSVVINQLRLSDAGQYLCQAGDDSNSNKKNADLQVLKPEPELVYEDLRGSVTFHCALGPEVANVAKFLCRQSSGENCDVVVNTLGKRAPAFEGRILLNPQDKDGSFSVVITGLRKEDAGRYLCGAHS
Gene ID - Mouse ENSMUSG00000026417
Gene ID - Rat ENSRNOG00000004405
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PIGR pAb (ATL-HPA012012 w/enhanced validation)
Datasheet Anti PIGR pAb (ATL-HPA012012 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PIGR pAb (ATL-HPA012012 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PIGR pAb (ATL-HPA012012 w/enhanced validation)
Datasheet Anti PIGR pAb (ATL-HPA012012 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PIGR pAb (ATL-HPA012012 w/enhanced validation)
Citations for Anti PIGR pAb (ATL-HPA012012 w/enhanced validation) – 5 Found
Trevisi, Paolo; Gandolfi, Greta; Priori, Davide; Messori, Stefano; Colombo, Michela; Mazzoni, Maurizio; Lallès, Jean-Paul; Bosi, Paolo. Age-related expression of the polymeric immunoglobulin receptor (pIgR) in the gastric mucosa of young pigs. Plos One. 8(11):e81473.  PubMed
Berntsson, Jonna; Lundgren, Sebastian; Nodin, Björn; Uhlén, Mathias; Gaber, Alexander; Jirström, Karin. Expression and prognostic significance of the polymeric immunoglobulin receptor in epithelial ovarian cancer. Journal Of Ovarian Research. 2014;7( 24568264):26.  PubMed
Fristedt, Richard; Gaber, Alexander; Hedner, Charlotta; Nodin, Björn; Uhlén, Mathias; Eberhard, Jakob; Jirström, Karin. Expression and prognostic significance of the polymeric immunoglobulin receptor in esophageal and gastric adenocarcinoma. Journal Of Translational Medicine. 2014;12( 24694107):83.  PubMed
Fristedt, Richard; Elebro, Jacob; Gaber, Alexander; Jonsson, Liv; Heby, Margareta; Yudina, Yulyana; Nodin, Björn; Uhlén, Mathias; Eberhard, Jakob; Jirström, Karin. Reduced expression of the polymeric immunoglobulin receptor in pancreatic and periampullary adenocarcinoma signifies tumour progression and poor prognosis. Plos One. 9(11):e112728.  PubMed
Rostami, Mahboubeh R; LeBlanc, Michelle G; Strulovici-Barel, Yael; Zuo, Wulin; Mezey, Jason G; O'Beirne, Sarah L; Kaner, Robert J; Leopold, Philip L; Crystal, Ronald G. Smoking shifts human small airway epithelium club cells toward a lesser differentiated population. Npj Genomic Medicine. 2021;6(1):73.  PubMed