Anti PIGC pAb (ATL-HPA036663)

Atlas Antibodies

Catalog No.: ATL-HPA036663-100

Protein Description: phosphatidylinositol glycan anchor biosynthesis, class C
Gene Name: PIGC
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026698: 97%, ENSRNOG00000026497: 97%
Entrez Gene ID: 5279
Uniprot ID: Q92535
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YLIRLQLFKENIHGPWDEAEIKEDLSRFLS
• Gene Sequence: YLIRLQLFKENIHGPWDEAEIKEDLSRFLS
• Gene ID - Mouse: ENSMUSG00000026698
• Gene ID - Rat: ENSRNOG00000026497
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PIGC pAb (ATL-HPA036663) – 1 Found

Peng, Xiulan; Lei, Changjiang; He, Anbing; Luo, Renfeng; Cai, Yahong; Dong, Weiguo. Upregulation of phosphatidylinositol glycan anchor biosynthesis class C is associated with unfavorable survival prognosis in patients with hepatocellular carcinoma. Oncology Letters. 2021;21(3):237.