Anti PID1 pAb (ATL-HPA036103)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036103-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PID1
Alternative Gene Name: FLJ20701, NYGGF4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045658: 93%, ENSRNOG00000029735: 93%
Entrez Gene ID: 55022
Uniprot ID: Q7Z2X4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VSPNIFAWVYREINDDLSYQMDCHAVECESKLEAKKLAHAMMEAFRKTFHSMKSDGRIHSNSSSEEVSQELESDDG |
| Gene Sequence | VSPNIFAWVYREINDDLSYQMDCHAVECESKLEAKKLAHAMMEAFRKTFHSMKSDGRIHSNSSSEEVSQELESDDG |
| Gene ID - Mouse | ENSMUSG00000045658 |
| Gene ID - Rat | ENSRNOG00000029735 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PID1 pAb (ATL-HPA036103) | |
| Datasheet | Anti PID1 pAb (ATL-HPA036103) Datasheet (External Link) |
| Vendor Page | Anti PID1 pAb (ATL-HPA036103) at Atlas Antibodies |
| Documents & Links for Anti PID1 pAb (ATL-HPA036103) | |
| Datasheet | Anti PID1 pAb (ATL-HPA036103) Datasheet (External Link) |
| Vendor Page | Anti PID1 pAb (ATL-HPA036103) |
| Citations for Anti PID1 pAb (ATL-HPA036103) – 2 Found |
| Bonala, Sabeera; McFarlane, Craig; Ang, Jackie; Lim, Radiance; Lee, Marcus; Chua, Hillary; Lokireddy, Sudarsanareddy; Sreekanth, Patnam; Leow, Melvin Khee Shing; Meng, Khoo Chin; Shyong, Tai E; Lee, Yung Seng; Gluckman, Peter D; Sharma, Mridula; Kambadur, Ravi. Pid1 induces insulin resistance in both human and mouse skeletal muscle during obesity. Molecular Endocrinology (Baltimore, Md.). 2013;27(9):1518-35. PubMed |
| Xu, Jingying; Ren, Xiuhai; Pathania, Anup Singh; Fernandez, G Esteban; Tran, Anthony; Zhang, Yifu; Moats, Rex A; Shackleford, Gregory M; Erdreich-Epstein, Anat. PID1 increases chemotherapy-induced apoptosis in medulloblastoma and glioblastoma cells in a manner that involves NFκB. Scientific Reports. 2017;7(1):835. PubMed |