Anti PICALM pAb (ATL-HPA019053 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019053-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PICALM
Alternative Gene Name: CALM, CLTH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039361: 93%, ENSRNOG00000018322: 88%
Entrez Gene ID: 8301
Uniprot ID: Q13492
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VHLSISSDVSTFTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLA |
| Gene Sequence | VHLSISSDVSTFTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLA |
| Gene ID - Mouse | ENSMUSG00000039361 |
| Gene ID - Rat | ENSRNOG00000018322 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PICALM pAb (ATL-HPA019053 w/enhanced validation) | |
| Datasheet | Anti PICALM pAb (ATL-HPA019053 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PICALM pAb (ATL-HPA019053 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti PICALM pAb (ATL-HPA019053 w/enhanced validation) | |
| Datasheet | Anti PICALM pAb (ATL-HPA019053 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PICALM pAb (ATL-HPA019053 w/enhanced validation) |
| Citations for Anti PICALM pAb (ATL-HPA019053 w/enhanced validation) – 3 Found |
| Heath, Jessica L; Weiss, Joshua M; Lavau, Catherine P; Wechsler, Daniel S. Effects of iron depletion on CALM-AF10 leukemias. Experimental Hematology. 2014;42(12):1022-1030.e1. PubMed |
| Storck, Steffen E; Hartz, Anika M S; Bernard, Jessica; Wolf, Andrea; Kachlmeier, André; Mahringer, Anne; Weggen, Sascha; Pahnke, Jens; Pietrzik, Claus U. The concerted amyloid-beta clearance of LRP1 and ABCB1/P-gp across the blood-brain barrier is linked by PICALM. Brain, Behavior, And Immunity. 2018;73( 30041013):21-33. PubMed |
| Ando, Kunie; Nagaraj, Siranjeevi; Küçükali, Fahri; de Fisenne, Marie-Ange; Kosa, Andreea-Claudia; Doeraene, Emilie; Lopez Gutierrez, Lidia; Brion, Jean-Pierre; Leroy, Karelle. PICALM and Alzheimer's Disease: An Update and Perspectives. Cells. 2022;11(24) PubMed |