Anti PICALM pAb (ATL-HPA019053 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA019053-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: phosphatidylinositol binding clathrin assembly protein
Gene Name: PICALM
Alternative Gene Name: CALM, CLTH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039361: 93%, ENSRNOG00000018322: 88%
Entrez Gene ID: 8301
Uniprot ID: Q13492
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen VHLSISSDVSTFTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLA
Gene Sequence VHLSISSDVSTFTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLA
Gene ID - Mouse ENSMUSG00000039361
Gene ID - Rat ENSRNOG00000018322
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PICALM pAb (ATL-HPA019053 w/enhanced validation)
Datasheet Anti PICALM pAb (ATL-HPA019053 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PICALM pAb (ATL-HPA019053 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PICALM pAb (ATL-HPA019053 w/enhanced validation)
Datasheet Anti PICALM pAb (ATL-HPA019053 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PICALM pAb (ATL-HPA019053 w/enhanced validation)
Citations for Anti PICALM pAb (ATL-HPA019053 w/enhanced validation) – 3 Found
Heath, Jessica L; Weiss, Joshua M; Lavau, Catherine P; Wechsler, Daniel S. Effects of iron depletion on CALM-AF10 leukemias. Experimental Hematology. 2014;42(12):1022-1030.e1.  PubMed
Storck, Steffen E; Hartz, Anika M S; Bernard, Jessica; Wolf, Andrea; Kachlmeier, André; Mahringer, Anne; Weggen, Sascha; Pahnke, Jens; Pietrzik, Claus U. The concerted amyloid-beta clearance of LRP1 and ABCB1/P-gp across the blood-brain barrier is linked by PICALM. Brain, Behavior, And Immunity. 2018;73( 30041013):21-33.  PubMed
Ando, Kunie; Nagaraj, Siranjeevi; Küçükali, Fahri; de Fisenne, Marie-Ange; Kosa, Andreea-Claudia; Doeraene, Emilie; Lopez Gutierrez, Lidia; Brion, Jean-Pierre; Leroy, Karelle. PICALM and Alzheimer's Disease: An Update and Perspectives. Cells. 2022;11(24)  PubMed