Anti PHYKPL pAb (ATL-HPA036461)

Atlas Antibodies

Catalog No.:
ATL-HPA036461-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: 5-phosphohydroxy-L-lysine phospho-lyase
Gene Name: PHYKPL
Alternative Gene Name: AGXT2L2, MGC15875
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020359: 86%, ENSRNOG00000047933: 91%
Entrez Gene ID: 85007
Uniprot ID: Q8IUZ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen TRTPATEEAAYLVSRLKENYVLLSTDGPGRNILKFKPPMCFSLDNARQVVAKLDAILTDMEEKVRSCETL
Gene Sequence TRTPATEEAAYLVSRLKENYVLLSTDGPGRNILKFKPPMCFSLDNARQVVAKLDAILTDMEEKVRSCETL
Gene ID - Mouse ENSMUSG00000020359
Gene ID - Rat ENSRNOG00000047933
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PHYKPL pAb (ATL-HPA036461)
Datasheet Anti PHYKPL pAb (ATL-HPA036461) Datasheet (External Link)
Vendor Page Anti PHYKPL pAb (ATL-HPA036461) at Atlas Antibodies

Documents & Links for Anti PHYKPL pAb (ATL-HPA036461)
Datasheet Anti PHYKPL pAb (ATL-HPA036461) Datasheet (External Link)
Vendor Page Anti PHYKPL pAb (ATL-HPA036461)