Anti PHLDB1 pAb (ATL-HPA037959)

Atlas Antibodies

Catalog No.:
ATL-HPA037959-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: pleckstrin homology-like domain, family B, member 1
Gene Name: PHLDB1
Alternative Gene Name: FLJ00141, KIAA0638, LL5a
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048537: 95%, ENSRNOG00000026985: 95%
Entrez Gene ID: 23187
Uniprot ID: Q86UU1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AILDSQAGQIRAQAVQESERLARDKNASLQLLQKEKEKLTVLERRYHSLTGGRPFPKTTSTLKEMEKLLLPAVDLEQWYQELM
Gene Sequence AILDSQAGQIRAQAVQESERLARDKNASLQLLQKEKEKLTVLERRYHSLTGGRPFPKTTSTLKEMEKLLLPAVDLEQWYQELM
Gene ID - Mouse ENSMUSG00000048537
Gene ID - Rat ENSRNOG00000026985
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PHLDB1 pAb (ATL-HPA037959)
Datasheet Anti PHLDB1 pAb (ATL-HPA037959) Datasheet (External Link)
Vendor Page Anti PHLDB1 pAb (ATL-HPA037959) at Atlas Antibodies

Documents & Links for Anti PHLDB1 pAb (ATL-HPA037959)
Datasheet Anti PHLDB1 pAb (ATL-HPA037959) Datasheet (External Link)
Vendor Page Anti PHLDB1 pAb (ATL-HPA037959)