Anti PHLDA3 pAb (ATL-HPA027601)

Atlas Antibodies

Catalog No.:
ATL-HPA027601-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: pleckstrin homology-like domain, family A, member 3
Gene Name: PHLDA3
Alternative Gene Name: TIH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041801: 100%, ENSRNOG00000009068: 99%
Entrez Gene ID: 23612
Uniprot ID: Q9Y5J5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LWKRKRCVLTERGLQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVR
Gene Sequence LWKRKRCVLTERGLQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVTEGGGEIDFRCPLEDPGWNAQITLGLVKFKNQQAIQTVR
Gene ID - Mouse ENSMUSG00000041801
Gene ID - Rat ENSRNOG00000009068
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PHLDA3 pAb (ATL-HPA027601)
Datasheet Anti PHLDA3 pAb (ATL-HPA027601) Datasheet (External Link)
Vendor Page Anti PHLDA3 pAb (ATL-HPA027601) at Atlas Antibodies

Documents & Links for Anti PHLDA3 pAb (ATL-HPA027601)
Datasheet Anti PHLDA3 pAb (ATL-HPA027601) Datasheet (External Link)
Vendor Page Anti PHLDA3 pAb (ATL-HPA027601)