Anti PHGDH pAb (ATL-HPA021241 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA021241-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: PHGDH
Alternative Gene Name: PDG, PGDH, SERA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053398: 99%, ENSRNOG00000019328: 99%
Entrez Gene ID: 26227
Uniprot ID: O43175
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDM |
| Gene Sequence | LEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDM |
| Gene ID - Mouse | ENSMUSG00000053398 |
| Gene ID - Rat | ENSRNOG00000019328 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PHGDH pAb (ATL-HPA021241 w/enhanced validation) | |
| Datasheet | Anti PHGDH pAb (ATL-HPA021241 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PHGDH pAb (ATL-HPA021241 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti PHGDH pAb (ATL-HPA021241 w/enhanced validation) | |
| Datasheet | Anti PHGDH pAb (ATL-HPA021241 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PHGDH pAb (ATL-HPA021241 w/enhanced validation) |
| Citations for Anti PHGDH pAb (ATL-HPA021241 w/enhanced validation) – 43 Found |
| Maddocks, Oliver D K; Berkers, Celia R; Mason, Susan M; Zheng, Liang; Blyth, Karen; Gottlieb, Eyal; Vousden, Karen H. Serine starvation induces stress and p53-dependent metabolic remodelling in cancer cells. Nature. 2013;493(7433):542-6. PubMed |
| Gromova, Irina; Gromov, Pavel; Honma, Naoko; Kumar, Sudha; Rimm, David; Talman, Maj-Lis Møller; Wielenga, Vera Timmermans; Moreira, José M A. High level PHGDH expression in breast is predominantly associated with keratin 5-positive cell lineage independently of malignancy. Molecular Oncology. 2015;9(8):1636-54. PubMed |
| DeNicola, Gina M; Chen, Pei-Hsuan; Mullarky, Edouard; Sudderth, Jessica A; Hu, Zeping; Wu, David; Tang, Hao; Xie, Yang; Asara, John M; Huffman, Kenneth E; Wistuba, Ignacio I; Minna, John D; DeBerardinis, Ralph J; Cantley, Lewis C. NRF2 regulates serine biosynthesis in non-small cell lung cancer. Nature Genetics. 2015;47(12):1475-81. PubMed |
| Polet, Florence; Corbet, Cyril; Pinto, Adan; Rubio, Laila Illan; Martherus, Ruben; Bol, Vanesa; Drozak, Xavier; Grégoire, Vincent; Riant, Olivier; Feron, Olivier. Reducing the serine availability complements the inhibition of the glutamine metabolism to block leukemia cell growth. Oncotarget. 2016;7(2):1765-76. PubMed |
| Mullarky, Edouard; Lucki, Natasha C; Beheshti Zavareh, Reza; Anglin, Justin L; Gomes, Ana P; Nicolay, Brandon N; Wong, Jenny C Y; Christen, Stefan; Takahashi, Hidenori; Singh, Pradeep K; Blenis, John; Warren, J David; Fendt, Sarah-Maria; Asara, John M; DeNicola, Gina M; Lyssiotis, Costas A; Lairson, Luke L; Cantley, Lewis C. Identification of a small molecule inhibitor of 3-phosphoglycerate dehydrogenase to target serine biosynthesis in cancers. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2016;113(7):1778-83. PubMed |
| Yoshino, Hirofumi; Nohata, Nijiro; Miyamoto, Kazutaka; Yonemori, Masaya; Sakaguchi, Takashi; Sugita, Satoshi; Itesako, Toshihiko; Kofuji, Satoshi; Nakagawa, Masayuki; Dahiya, Rajvir; Enokida, Hideki. PHGDH as a Key Enzyme for Serine Biosynthesis in HIF2α-Targeting Therapy for Renal Cell Carcinoma. Cancer Research. 2017;77(22):6321-6329. PubMed |
| Hauser, David N; Mamais, Adamantios; Conti, Melissa M; Primiani, Christopher T; Kumaran, Ravindran; Dillman, Allissa A; Langston, Rebekah G; Beilina, Alexandra; Garcia, Joseph H; Diaz-Ruiz, Alberto; Bernier, Michel; Fiesel, Fabienne C; Hou, Xu; Springer, Wolfdieter; Li, Yan; de Cabo, Rafael; Cookson, Mark R. Hexokinases link DJ-1 to the PINK1/parkin pathway. Molecular Neurodegeneration. 2017;12(1):70. PubMed |
| Unterlass, Judith E; Baslé, Arnaud; Blackburn, Timothy J; Tucker, Julie; Cano, Céline; Noble, Martin E M; Curtin, Nicola J. Validating and enabling phosphoglycerate dehydrogenase (PHGDH) as a target for fragment-based drug discovery in PHGDH-amplified breast cancer. Oncotarget. 2018;9(17):13139-13153. PubMed |
| Mattaini, Katherine R; Sullivan, Mark R; Lau, Allison N; Fiske, Brian P; Bronson, Roderick T; Vander Heiden, Matthew G. Increased PHGDH expression promotes aberrant melanin accumulation. Bmc Cancer. 2019;19(1):723. PubMed |
| Rinaldi, Gianmarco; Pranzini, Erica; Van Elsen, Joke; Broekaert, Dorien; Funk, Cornelius M; Planque, Mélanie; Doglioni, Ginevra; Altea-Manzano, Patricia; Rossi, Matteo; Geldhof, Vincent; Teoh, Shao Thing; Ross, Christina; Hunter, Kent W; Lunt, Sophia Y; Grünewald, Thomas G P; Fendt, Sarah-Maria. In Vivo Evidence for Serine Biosynthesis-Defined Sensitivity of Lung Metastasis, but Not of Primary Breast Tumors, to mTORC1 Inhibition. Molecular Cell. 2021;81(2):386-397.e7. PubMed |
| Rathore, Richa; Caldwell, Katharine E; Schutt, Charles; Brashears, Caitlyn B; Prudner, Bethany C; Ehrhardt, William R; Leung, Cheuk Hong; Lin, Heather; Daw, Najat C; Beird, Hannah C; Giles, Abigail; Wang, Wei-Lien; Lazar, Alexander J; Chrisinger, John S A; Livingston, J Andrew; Van Tine, Brian A. Metabolic compensation activates pro-survival mTORC1 signaling upon 3-phosphoglycerate dehydrogenase inhibition in osteosarcoma. Cell Reports. 2021;34(4):108678. PubMed |
| Wiese, Elizabeth K; Hitosugi, Sadae; Loa, Sharon T; Sreedhar, Annapoorna; Andres-Beck, Lindsey G; Kurmi, Kiran; Pang, Yuan-Ping; Karnitz, Larry M; Gonsalves, Wilson I; Hitosugi, Taro. Enzymatic activation of pyruvate kinase increases cytosolic oxaloacetate to inhibit the Warburg effect. Nature Metabolism. 2021;3(7):954-968. PubMed |
| Byles, Vanessa; Cormerais, Yann; Kalafut, Krystle; Barrera, Victor; Hughes Hallett, James E; Sui, Shannan Ho; Asara, John M; Adams, Christopher M; Hoxhaj, Gerta; Ben-Sahra, Issam; Manning, Brendan D. Hepatic mTORC1 signaling activates ATF4 as part of its metabolic response to feeding and insulin. Molecular Metabolism. 2021;53( 34303878):101309. PubMed |
| Fan, Zheng; Turiel, Guillermo; Ardicoglu, Raphaela; Ghobrial, Moheb; Masschelein, Evi; Kocijan, Tea; Zhang, Jing; Tan, Ge; Fitzgerald, Gillian; Gorski, Tatiane; Alvarado-Diaz, Abdiel; Gilardoni, Paola; Adams, Christopher M; Ghesquière, Bart; De Bock, Katrien. Exercise-induced angiogenesis is dependent on metabolically primed ATF3/4(+) endothelial cells. Cell Metabolism. 2021;33(9):1793-1807.e9. PubMed |
| Li, Xingyao; Gracilla, Daniel; Cai, Lun; Zhang, Mingyi; Yu, Xiaolin; Chen, Xiaoguang; Zhang, Junran; Long, Xiaochun; Ding, Han-Fei; Yan, Chunhong. ATF3 promotes the serine synthesis pathway and tumor growth under dietary serine restriction. Cell Reports. 2021;36(12):109706. PubMed |
| Choi, Bo-Hyun; Rawat, Vipin; Högström, Jenny; Burns, Philippa A; Conger, Kelly O; Ozgurses, Mete Emir; Patel, Jaymin M; Mehta, Tejas S; Warren, Angelica; Selfors, Laura M; Muranen, Taru; Coloff, Jonathan L. Lineage-specific silencing of PSAT1 induces serine auxotrophy and sensitivity to dietary serine starvation in luminal breast tumors. Cell Reports. 2022;38(3):110278. PubMed |
| Vivet-Noguer, Raquel; Tarin, Malcy; Canbezdi, Christine; Dayot, Stephane; Silva, Lisseth; Houy, Alexandre; Martineau, Sylvain; Mieulet, Virginie; Gentric, Géraldine; Loew, Damarys; Lombard, Bérangère; Nemati, Fariba; Richon, Sophie; Guyonnet, Lea; Servois, Vincent; Vagner, Stephan; Stern, Marc-Henri; Roman-Roman, Sergio; Alsafadi, Samar. Glycolysis Dependency as a Hallmark of SF3B1-Mutated Cells. Cancers. 2022;14(9) PubMed |
| Possemato, Richard; Marks, Kevin M; Shaul, Yoav D; Pacold, Michael E; Kim, Dohoon; Birsoy, Kıvanç; Sethumadhavan, Shalini; Woo, Hin-Koon; Jang, Hyun G; Jha, Abhishek K; Chen, Walter W; Barrett, Francesca G; Stransky, Nicolas; Tsun, Zhi-Yang; Cowley, Glenn S; Barretina, Jordi; Kalaany, Nada Y; Hsu, Peggy P; Ottina, Kathleen; Chan, Albert M; Yuan, Bingbing; Garraway, Levi A; Root, David E; Mino-Kenudson, Mari; Brachtel, Elena F; Driggers, Edward M; Sabatini, David M. Functional genomics reveal that the serine synthesis pathway is essential in breast cancer. Nature. 2011;476(7360):346-50. PubMed |
| Nilsson, Lisa M; Forshell, Tacha Zi Plym; Rimpi, Sara; Kreutzer, Christiane; Pretsch, Walter; Bornkamm, Georg W; Nilsson, Jonas A. Mouse genetics suggests cell-context dependency for Myc-regulated metabolic enzymes during tumorigenesis. Plos Genetics. 8(3):e1002573. PubMed |
| Ou, Yang; Wang, Shang-Jui; Jiang, Le; Zheng, Bin; Gu, Wei. p53 Protein-mediated regulation of phosphoglycerate dehydrogenase (PHGDH) is crucial for the apoptotic response upon serine starvation. The Journal Of Biological Chemistry. 2015;290(1):457-66. PubMed |
| Markkanen, Enni; Fischer, Roman; Ledentcova, Marina; Kessler, Benedikt M; Dianov, Grigory L. Cells deficient in base-excision repair reveal cancer hallmarks originating from adjustments to genetic instability. Nucleic Acids Research. 2015;43(7):3667-79. PubMed |
| Mattaini, Katherine R; Brignole, Edward J; Kini, Mitali; Davidson, Shawn M; Fiske, Brian P; Drennan, Catherine L; Vander Heiden, Matthew G. An epitope tag alters phosphoglycerate dehydrogenase structure and impairs ability to support cell proliferation. Cancer & Metabolism. 3( 25926973):5. PubMed |
| Pacold, Michael E; Brimacombe, Kyle R; Chan, Sze Ham; Rohde, Jason M; Lewis, Caroline A; Swier, Lotteke J Y M; Possemato, Richard; Chen, Walter W; Sullivan, Lucas B; Fiske, Brian P; Cho, Steve; Freinkman, Elizaveta; Birsoy, Kıvanç; Abu-Remaileh, Monther; Shaul, Yoav D; Liu, Chieh Min; Zhou, Minerva; Koh, Min Jung; Chung, Haeyoon; Davidson, Shawn M; Luengo, Alba; Wang, Amy Q; Xu, Xin; Yasgar, Adam; Liu, Li; Rai, Ganesha; Westover, Kenneth D; Vander Heiden, Matthew G; Shen, Min; Gray, Nathanael S; Boxer, Matthew B; Sabatini, David M. A PHGDH inhibitor reveals coordination of serine synthesis and one-carbon unit fate. Nature Chemical Biology. 2016;12(6):452-8. PubMed |
| Brown, D M; Williams, H; Ryan, K J P; Wilson, T L; Daniel, Z C T R; Mareko, M H D; Emes, R D; Harris, D W; Jones, S; Wattis, J A D; Dryden, I L; Hodgman, T C; Brameld, J M; Parr, T. Mitochondrial phosphoenolpyruvate carboxykinase (PEPCK-M) and serine biosynthetic pathway genes are co-ordinately increased during anabolic agent-induced skeletal muscle growth. Scientific Reports. 2016;6( 27350173):28693. PubMed |
| Hulea, Laura; Gravel, Simon-Pierre; Morita, Masahiro; Cargnello, Marie; Uchenunu, Oro; Im, Young Kyuen; Lehuédé, Camille; Ma, Eric H; Leibovitch, Matthew; McLaughlan, Shannon; Blouin, Marie-José; Parisotto, Maxime; Papavasiliou, Vasilios; Lavoie, Cynthia; Larsson, Ola; Ohh, Michael; Ferreira, Tiago; Greenwood, Celia; Bridon, Gaëlle; Avizonis, Daina; Ferbeyre, Gerardo; Siegel, Peter; Jones, Russell G; Muller, William; Ursini-Siegel, Josie; St-Pierre, Julie; Pollak, Michael; Topisirovic, Ivan. Translational and HIF-1α-Dependent Metabolic Reprogramming Underpin Metabolic Plasticity and Responses to Kinase Inhibitors and Biguanides. Cell Metabolism. 2018;28(6):817-832.e8. PubMed |
| Sullivan, Mark R; Mattaini, Katherine R; Dennstedt, Emily A; Nguyen, Anna A; Sivanand, Sharanya; Reilly, Montana F; Meeth, Katrina; Muir, Alexander; Darnell, Alicia M; Bosenberg, Marcus W; Lewis, Caroline A; Vander Heiden, Matthew G. Increased Serine Synthesis Provides an Advantage for Tumors Arising in Tissues Where Serine Levels Are Limiting. Cell Metabolism. 2019;29(6):1410-1421.e4. PubMed |
| Dalton, W Brian; Helmenstine, Eric; Walsh, Noel; Gondek, Lukasz P; Kelkar, Dhanashree S; Read, Abigail; Natrajan, Rachael; Christenson, Eric S; Roman, Barbara; Das, Samarjit; Zhao, Liang; Leone, Robert D; Shinn, Daniel; Groginski, Taylor; Madugundu, Anil K; Patil, Arun; Zabransky, Daniel J; Medford, Arielle; Lee, Justin; Cole, Alex J; Rosen, Marc; Thakar, Maya; Ambinder, Alexander; Donaldson, Joshua; DeZern, Amy E; Cravero, Karen; Chu, David; Madero-Marroquin, Rafael; Pandey, Akhilesh; Hurley, Paula J; Lauring, Josh; Park, Ben Ho. Hotspot SF3B1 mutations induce metabolic reprogramming and vulnerability to serine deprivation. The Journal Of Clinical Investigation. 2019;129(11):4708-4723. PubMed |
| Wei, Lai; Lee, Derek; Law, Cheuk-Ting; Zhang, Misty Shuo; Shen, Jialing; Chin, Don Wai-Ching; Zhang, Allen; Tsang, Felice Ho-Ching; Wong, Ceci Lok-Sze; Ng, Irene Oi-Lin; Wong, Carmen Chak-Lui; Wong, Chun-Ming. Genome-wide CRISPR/Cas9 library screening identified PHGDH as a critical driver for Sorafenib resistance in HCC. Nature Communications. 2019;10(1):4681. PubMed |
| Li, Kai; Wu, Jian-Lin; Qin, Baifu; Fan, Zongmin; Tang, Qin; Lu, Weisi; Zhang, Haipeng; Xing, Fan; Meng, Manqi; Zou, Shaomin; Wei, Wenxia; Chen, Honglei; Cai, Jian; Wang, Huaiming; Zhang, Hui; Cai, Jiayue; Fang, Ling; Bian, Xiqing; Chen, Chuangqi; Lan, Ping; Ghesquière, Bart; Fang, Lekun; Lee, Mong-Hong. ILF3 is a substrate of SPOP for regulating serine biosynthesis in colorectal cancer. Cell Research. 2020;30(2):163-178. PubMed |
| Wilcz-Villega, Ewa; Carter, Edward; Ironside, Alastair; Xu, Ruoyan; Mataloni, Isabella; Holdsworth, Julie; Jones, William; Moreno Béjar, Rocío; Uhlik, Lukas; Bentham, Robert B; Godinho, Susana A; Dalli, Jesmond; Grose, Richard; Szabadkai, Gyorgy; Jones, Louise; Hodivala-Dilke, Kairbaan; Bianchi, Katiuscia. Macrophages induce malignant traits in mammary epithelium via IKKε/TBK1 kinases and the serine biosynthesis pathway. Embo Molecular Medicine. 2020;12(2):e10491. PubMed |
| Spillier, Quentin; Ravez, Séverine; Unterlass, Judith; Corbet, Cyril; Degavre, Charline; Feron, Olivier; Frédérick, Raphaël. Structure-Activity Relationships (SARs) of α-Ketothioamides as Inhibitors of Phosphoglycerate Dehydrogenase (PHGDH). Pharmaceuticals (Basel, Switzerland). 2020;13(2) PubMed |
| Yoshino, Hirofumi; Enokida, Hideki; Osako, Yoichi; Nohata, Nijiro; Yonemori, Masaya; Sugita, Satoshi; Kuroshima, Kazuki; Tsuruda, Masafumi; Tatarano, Shuichi; Nakagawa, Masayuki. Characterization of PHGDH expression in bladder cancer: potential targeting therapy with gemcitabine/cisplatin and the contribution of promoter DNA hypomethylation. Molecular Oncology. 2020;14(9):2190-2202. PubMed |
| Liu, Juan; Zhang, Cen; Wu, Hao; Sun, Xiao-Xin; Li, Yanchen; Huang, Shan; Yue, Xuetian; Lu, Shou-En; Shen, Zhiyuan; Su, Xiaoyang; White, Eileen; Haffty, Bruce G; Hu, Wenwei; Feng, Zhaohui. Parkin ubiquitinates phosphoglycerate dehydrogenase to suppress serine synthesis and tumor progression. The Journal Of Clinical Investigation. 2020;130(6):3253-3269. PubMed |
| Kang, Yun Pyo; Falzone, Aimee; Liu, Min; González-Sánchez, Paloma; Choi, Bo-Hyun; Coloff, Jonathan L; Saller, James J; Karreth, Florian A; DeNicola, Gina M. PHGDH supports liver ceramide synthesis and sustains lipid homeostasis. Cancer & Metabolism. 8( 32549981):6. PubMed |
| Ngo, Bryan; Kim, Eugenie; Osorio-Vasquez, Victoria; Doll, Sophia; Bustraan, Sophia; Liang, Roger J; Luengo, Alba; Davidson, Shawn M; Ali, Ahmed; Ferraro, Gino B; Fischer, Grant M; Eskandari, Roozbeh; Kang, Diane S; Ni, Jing; Plasger, Ariana; Rajasekhar, Vinagolu K; Kastenhuber, Edward R; Bacha, Sarah; Sriram, Roshan K; Stein, Benjamin D; Bakhoum, Samuel F; Snuderl, Matija; Cotzia, Paolo; Healey, John H; Mainolfi, Nello; Suri, Vipin; Friedman, Adam; Manfredi, Mark; Sabatini, David M; Jones, Drew R; Yu, Min; Zhao, Jean J; Jain, Rakesh K; Keshari, Kayvan R; Davies, Michael A; Vander Heiden, Matthew G; Hernando, Eva; Mann, Matthias; Cantley, Lewis C; Pacold, Michael E. Limited Environmental Serine and Glycine Confer Brain Metastasis Sensitivity to PHGDH Inhibition. Cancer Discovery. 2020;10(9):1352-1373. PubMed |
| Xu, Ruoyan; Jones, William; Wilcz-Villega, Ewa; Costa, Ana Sh; Rajeeve, Vinothini; Bentham, Robert B; Bryson, Kevin; Nagano, Ai; Yaman, Busra; Olendo Barasa, Sheila; Wang, Yewei; Chelala, Claude; Cutillas, Pedro; Szabadkai, Gyorgy; Frezza, Christian; Bianchi, Katiuscia. The breast cancer oncogene IKKε coordinates mitochondrial function and serine metabolism. Embo Reports. 2020;21(9):e48260. PubMed |
| Tajan, Mylène; Hennequart, Marc; Cheung, Eric C; Zani, Fabio; Hock, Andreas K; Legrave, Nathalie; Maddocks, Oliver D K; Ridgway, Rachel A; Athineos, Dimitris; Suárez-Bonnet, Alejandro; Ludwig, Robert L; Novellasdemunt, Laura; Angelis, Nikolaos; Li, Vivian S W; Vlachogiannis, Georgios; Valeri, Nicola; Mainolfi, Nello; Suri, Vipin; Friedman, Adam; Manfredi, Mark; Blyth, Karen; Sansom, Owen J; Vousden, Karen H. Serine synthesis pathway inhibition cooperates with dietary serine and glycine limitation for cancer therapy. Nature Communications. 2021;12(1):366. PubMed |
| Kiweler, Nicole; Delbrouck, Catherine; Pozdeev, Vitaly I; Neises, Laura; Soriano-Baguet, Leticia; Eiden, Kim; Xian, Feng; Benzarti, Mohaned; Haase, Lara; Koncina, Eric; Schmoetten, Maryse; Jaeger, Christian; Noman, Muhammad Zaeem; Vazquez, Alexei; Janji, Bassam; Dittmar, Gunnar; Brenner, Dirk; Letellier, Elisabeth; Meiser, Johannes. Mitochondria preserve an autarkic one-carbon cycle to confer growth-independent cancer cell migration and metastasis. Nature Communications. 2022;13(1):2699. PubMed |
| Yao, Sha; Peng, Luogen; Elakad, Omar; Küffer, Stefan; Hinterthaner, Marc; Danner, Bernhard C; von Hammerstein-Equord, Alexander; Ströbel, Philipp; Bohnenberger, Hanibal. One carbon metabolism in human lung cancer. Translational Lung Cancer Research. 2021;10(6):2523-2538. PubMed |
| Van Nyen, Tom; Planque, Mélanie; van Wagensveld, Lilian; Duarte, Joao A G; Zaal, Esther A; Talebi, Ali; Rossi, Matteo; Körner, Pierre-René; Rizzotto, Lara; Moens, Stijn; De Wispelaere, Wout; Baiden-Amissah, Regina E M; Sonke, Gabe S; Horlings, Hugo M; Eelen, Guy; Berardi, Emanuele; Swinnen, Johannes V; Berkers, Celia R; Carmeliet, Peter; Lambrechts, Diether; Davidson, Ben; Agami, Reuven; Fendt, Sarah-Maria; Annibali, Daniela; Amant, Frédéric. Serine metabolism remodeling after platinum-based chemotherapy identifies vulnerabilities in a subgroup of resistant ovarian cancers. Nature Communications. 2022;13(1):4578. PubMed |
| Metcalf, Stephanie; Petri, Belinda J; Kruer, Traci; Green, Benjamin; Dougherty, Susan; Wittliff, James L; Klinge, Carolyn M; Clem, Brian F. Serine synthesis influences tamoxifen response in ER+ human breast carcinoma. Endocrine-Related Cancer. 2021;28(1):27-37. PubMed |
| Wang, Han; Hu, Moran; Ding, Zhaoxue; Zhou, Xiaolong; Yang, Songbai; Shen, Zhonghao; Yan, Feifei; Zhao, Ayong. Phosphoglycerate dehydrogenase positively regulates the proliferation of chicken muscle cells. Poultry Science. 2022;101(5):101805. PubMed |
| Eade, Kevin; Gantner, Marin L; Hostyk, Joseph A; Nagasaki, Takayuki; Giles, Sarah; Fallon, Regis; Harkins-Perry, Sarah; Baldini, Michelle; Lim, Esther W; Scheppke, Lea; Dorrell, Michael I; Cai, Carolyn; Baugh, Evan H; Wolock, Charles J; Wallace, Martina; Berlow, Rebecca B; Goldstein, David B; Metallo, Christian M; Friedlander, Martin; Allikmets, Rando. Serine biosynthesis defect due to haploinsufficiency of PHGDH causes retinal disease. Nature Metabolism. 2021;3(3):366-377. PubMed |