Anti PHF13 pAb (ATL-HPA026830)

Atlas Antibodies

Catalog No.: ATL-HPA026830-100

Protein Description: PHD finger protein 13
Gene Name: PHF13
Alternative Gene Name: MGC43399
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047777: 100%, ENSRNOG00000009046: 100%
Entrez Gene ID: 148479
Uniprot ID: Q86YI8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GKRTIVRQGKQVVFRDEDSTGNDEDIMVDSDDDSWDLVTCFCMKPFAGRPMIECNECHT
• Gene Sequence: GKRTIVRQGKQVVFRDEDSTGNDEDIMVDSDDDSWDLVTCFCMKPFAGRPMIECNECHT
• Gene ID - Mouse: ENSMUSG00000047777
• Gene ID - Rat: ENSRNOG00000009046
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.