Anti PHF1 pAb (ATL-HPA031038)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031038-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PHF1
Alternative Gene Name: MTF2L2, TDRD19C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024193: 96%, ENSRNOG00000000480: 96%
Entrez Gene ID: 5252
Uniprot ID: O43189
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ACTQCLSKPLLYGDRFYEFECCVCRGGPEKVRRLQLRWVDVAHLVLYHLSVCCKKKYFDFDREILPFTSENWDSLLLGELSDTPKGERSSKLLSALNSHKDRFISGREIKKRKCLFGLHARMPPPVEPPTGDGALTS |
| Gene Sequence | ACTQCLSKPLLYGDRFYEFECCVCRGGPEKVRRLQLRWVDVAHLVLYHLSVCCKKKYFDFDREILPFTSENWDSLLLGELSDTPKGERSSKLLSALNSHKDRFISGREIKKRKCLFGLHARMPPPVEPPTGDGALTS |
| Gene ID - Mouse | ENSMUSG00000024193 |
| Gene ID - Rat | ENSRNOG00000000480 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PHF1 pAb (ATL-HPA031038) | |
| Datasheet | Anti PHF1 pAb (ATL-HPA031038) Datasheet (External Link) |
| Vendor Page | Anti PHF1 pAb (ATL-HPA031038) at Atlas Antibodies |
| Documents & Links for Anti PHF1 pAb (ATL-HPA031038) | |
| Datasheet | Anti PHF1 pAb (ATL-HPA031038) Datasheet (External Link) |
| Vendor Page | Anti PHF1 pAb (ATL-HPA031038) |