Anti PHF1 pAb (ATL-HPA031038)

Atlas Antibodies

Catalog No.:
ATL-HPA031038-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: PHD finger protein 1
Gene Name: PHF1
Alternative Gene Name: MTF2L2, TDRD19C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024193: 96%, ENSRNOG00000000480: 96%
Entrez Gene ID: 5252
Uniprot ID: O43189
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ACTQCLSKPLLYGDRFYEFECCVCRGGPEKVRRLQLRWVDVAHLVLYHLSVCCKKKYFDFDREILPFTSENWDSLLLGELSDTPKGERSSKLLSALNSHKDRFISGREIKKRKCLFGLHARMPPPVEPPTGDGALTS
Gene Sequence ACTQCLSKPLLYGDRFYEFECCVCRGGPEKVRRLQLRWVDVAHLVLYHLSVCCKKKYFDFDREILPFTSENWDSLLLGELSDTPKGERSSKLLSALNSHKDRFISGREIKKRKCLFGLHARMPPPVEPPTGDGALTS
Gene ID - Mouse ENSMUSG00000024193
Gene ID - Rat ENSRNOG00000000480
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PHF1 pAb (ATL-HPA031038)
Datasheet Anti PHF1 pAb (ATL-HPA031038) Datasheet (External Link)
Vendor Page Anti PHF1 pAb (ATL-HPA031038) at Atlas Antibodies

Documents & Links for Anti PHF1 pAb (ATL-HPA031038)
Datasheet Anti PHF1 pAb (ATL-HPA031038) Datasheet (External Link)
Vendor Page Anti PHF1 pAb (ATL-HPA031038)