Anti PHB pAb (ATL-HPA003280 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA003280-25

Protein Description: prohibitin
Gene Name: PHB
Alternative Gene Name: PHB1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038845: 100%, ENSRNOG00000046799: 100%
Entrez Gene ID: 5245
Uniprot ID: P35232
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLP
• Gene Sequence: DVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLP
• Gene ID - Mouse: ENSMUSG00000038845
• Gene ID - Rat: ENSRNOG00000046799
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PHB pAb (ATL-HPA003280 w/enhanced validation) – 5 Found

Salameh, Ahmad; Daquinag, Alexes C; Staquicini, Daniela I; An, Zhiqiang; Hajjar, Katherine A; Pasqualini, Renata; Arap, Wadih; Kolonin, Mikhail G. Prohibitin/annexin 2 interaction regulates fatty acid transport in adipose tissue. Jci Insight. 2016;1(10) 

Daquinag, Alexes C; Gao, Zhanguo; Fussell, Cale; Immaraj, Linnet; Pasqualini, Renata; Arap, Wadih; Akimzhanov, Askar M; Febbraio, Maria; Kolonin, Mikhail G. Fatty acid mobilization from adipose tissue is mediated by CD36 posttranslational modifications and intracellular trafficking. Jci Insight. 2021;6(17) 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Koziol, Uriel; Rauschendorfer, Theresa; Zanon Rodríguez, Luis; Krohne, Georg; Brehm, Klaus. The unique stem cell system of the immortal larva of the human parasite Echinococcus multilocularis. Evodevo. 2014;5(1):10. 

Johnson, Gregory R; Li, Jieyue; Shariff, Aabid; Rohde, Gustavo K; Murphy, Robert F. Automated Learning of Subcellular Variation among Punctate Protein Patterns and a Generative Model of Their Relation to Microtubules. Plos Computational Biology. 2015;11(12):e1004614.