Anti PHACTR4 pAb (ATL-HPA028985)

Atlas Antibodies

Catalog No.:
ATL-HPA028985-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: phosphatase and actin regulator 4
Gene Name: PHACTR4
Alternative Gene Name: FLJ13171, PPP1R124
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066043: 79%, ENSRNOG00000046922: 80%
Entrez Gene ID: 65979
Uniprot ID: Q8IZ21
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GRTRSLPITIEMLKVPDDEEEEEQTCPSTFSEEMTPTSVIPKLPQCLREEEEKESDSDSEGPIQYRDEEDEDESYQSALANKVKRKDTLAMKLNHRPSE
Gene Sequence GRTRSLPITIEMLKVPDDEEEEEQTCPSTFSEEMTPTSVIPKLPQCLREEEEKESDSDSEGPIQYRDEEDEDESYQSALANKVKRKDTLAMKLNHRPSE
Gene ID - Mouse ENSMUSG00000066043
Gene ID - Rat ENSRNOG00000046922
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PHACTR4 pAb (ATL-HPA028985)
Datasheet Anti PHACTR4 pAb (ATL-HPA028985) Datasheet (External Link)
Vendor Page Anti PHACTR4 pAb (ATL-HPA028985) at Atlas Antibodies

Documents & Links for Anti PHACTR4 pAb (ATL-HPA028985)
Datasheet Anti PHACTR4 pAb (ATL-HPA028985) Datasheet (External Link)
Vendor Page Anti PHACTR4 pAb (ATL-HPA028985)
Citations for Anti PHACTR4 pAb (ATL-HPA028985) – 1 Found
Solimini, Nicole L; Liang, Anthony C; Xu, Chunxiao; Pavlova, Natalya N; Xu, Qikai; Davoli, Teresa; Li, Mamie Z; Wong, Kwok-Kin; Elledge, Stephen J. STOP gene Phactr4 is a tumor suppressor. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2013;110(5):E407-14.  PubMed