Anti PHACTR4 pAb (ATL-HPA028985)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028985-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PHACTR4
Alternative Gene Name: FLJ13171, PPP1R124
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066043: 79%, ENSRNOG00000046922: 80%
Entrez Gene ID: 65979
Uniprot ID: Q8IZ21
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GRTRSLPITIEMLKVPDDEEEEEQTCPSTFSEEMTPTSVIPKLPQCLREEEEKESDSDSEGPIQYRDEEDEDESYQSALANKVKRKDTLAMKLNHRPSE |
| Gene Sequence | GRTRSLPITIEMLKVPDDEEEEEQTCPSTFSEEMTPTSVIPKLPQCLREEEEKESDSDSEGPIQYRDEEDEDESYQSALANKVKRKDTLAMKLNHRPSE |
| Gene ID - Mouse | ENSMUSG00000066043 |
| Gene ID - Rat | ENSRNOG00000046922 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PHACTR4 pAb (ATL-HPA028985) | |
| Datasheet | Anti PHACTR4 pAb (ATL-HPA028985) Datasheet (External Link) |
| Vendor Page | Anti PHACTR4 pAb (ATL-HPA028985) at Atlas Antibodies |
| Documents & Links for Anti PHACTR4 pAb (ATL-HPA028985) | |
| Datasheet | Anti PHACTR4 pAb (ATL-HPA028985) Datasheet (External Link) |
| Vendor Page | Anti PHACTR4 pAb (ATL-HPA028985) |
| Citations for Anti PHACTR4 pAb (ATL-HPA028985) – 1 Found |
| Solimini, Nicole L; Liang, Anthony C; Xu, Chunxiao; Pavlova, Natalya N; Xu, Qikai; Davoli, Teresa; Li, Mamie Z; Wong, Kwok-Kin; Elledge, Stephen J. STOP gene Phactr4 is a tumor suppressor. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2013;110(5):E407-14. PubMed |