Anti PHACTR3 pAb (ATL-HPA051834)

Atlas Antibodies

Catalog No.:
ATL-HPA051834-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: phosphatase and actin regulator 3
Gene Name: PHACTR3
Alternative Gene Name: C20orf101, PPP1R123
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027525: 79%, ENSRNOG00000057996: 67%
Entrez Gene ID: 116154
Uniprot ID: Q96KR7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLKQTTSALEKKMAGRQGREELIKKGLLEMMEQDAESKTCNPDGGPRSVQSEPPTPKSETLTSEDAQPGS
Gene Sequence KLKQTTSALEKKMAGRQGREELIKKGLLEMMEQDAESKTCNPDGGPRSVQSEPPTPKSETLTSEDAQPGS
Gene ID - Mouse ENSMUSG00000027525
Gene ID - Rat ENSRNOG00000057996
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PHACTR3 pAb (ATL-HPA051834)
Datasheet Anti PHACTR3 pAb (ATL-HPA051834) Datasheet (External Link)
Vendor Page Anti PHACTR3 pAb (ATL-HPA051834) at Atlas Antibodies

Documents & Links for Anti PHACTR3 pAb (ATL-HPA051834)
Datasheet Anti PHACTR3 pAb (ATL-HPA051834) Datasheet (External Link)
Vendor Page Anti PHACTR3 pAb (ATL-HPA051834)