Anti PHACTR3 pAb (ATL-HPA051834)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051834-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PHACTR3
Alternative Gene Name: C20orf101, PPP1R123
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027525: 79%, ENSRNOG00000057996: 67%
Entrez Gene ID: 116154
Uniprot ID: Q96KR7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KLKQTTSALEKKMAGRQGREELIKKGLLEMMEQDAESKTCNPDGGPRSVQSEPPTPKSETLTSEDAQPGS |
Gene Sequence | KLKQTTSALEKKMAGRQGREELIKKGLLEMMEQDAESKTCNPDGGPRSVQSEPPTPKSETLTSEDAQPGS |
Gene ID - Mouse | ENSMUSG00000027525 |
Gene ID - Rat | ENSRNOG00000057996 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti PHACTR3 pAb (ATL-HPA051834) | |
Datasheet | Anti PHACTR3 pAb (ATL-HPA051834) Datasheet (External Link) |
Vendor Page | Anti PHACTR3 pAb (ATL-HPA051834) at Atlas Antibodies |
Documents & Links for Anti PHACTR3 pAb (ATL-HPA051834) | |
Datasheet | Anti PHACTR3 pAb (ATL-HPA051834) Datasheet (External Link) |
Vendor Page | Anti PHACTR3 pAb (ATL-HPA051834) |