Anti PGR pAb (ATL-HPA004751 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA004751-25

Protein Description: progesterone receptor
Gene Name: PGR
Alternative Gene Name: NR3C3, PR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031870: 88%, ENSRNOG00000006831: 88%
Entrez Gene ID: 5241
Uniprot ID: P06401
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RVVRALDAVALPQPVGVPNESQALSQRFTFSPGQDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKS
• Gene Sequence: RVVRALDAVALPQPVGVPNESQALSQRFTFSPGQDIQLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKS
• Gene ID - Mouse: ENSMUSG00000031870
• Gene ID - Rat: ENSRNOG00000006831
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PGR pAb (ATL-HPA004751 w/enhanced validation) – 1 Found

Pereira, Cynthia Brito Lins; Leal, Mariana Ferreira; de Souza, Carolina Rosal Teixeira; Montenegro, Raquel Carvalho; Rey, Juan Antonio; Carvalho, Antônio Alberto; Assumpção, Paulo Pimentel; Khayat, André Salim; Pinto, Giovanny Rebouças; Demachki, Sâmia; de Arruda Cardoso Smith, Marília; Burbano, Rommel Rodríguez. Prognostic and predictive significance of MYC and KRAS alterations in breast cancer from women treated with neoadjuvant chemotherapy. Plos One. 8(3):e60576.