Anti PGPEP1L pAb (ATL-HPA041781)

Atlas Antibodies

Catalog No.:
ATL-HPA041781-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: pyroglutamyl-peptidase I-like
Gene Name: PGPEP1L
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030553: 69%, ENSRNOG00000058956: 62%
Entrez Gene ID: 145814
Uniprot ID: A6NFU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VHVGMDTAAKAIILEQSGKNQGYRDADIRSFWPEGGVCLPGSPDVLESGVCMKAVCKRVAVEGVDVIF
Gene Sequence VHVGMDTAAKAIILEQSGKNQGYRDADIRSFWPEGGVCLPGSPDVLESGVCMKAVCKRVAVEGVDVIF
Gene ID - Mouse ENSMUSG00000030553
Gene ID - Rat ENSRNOG00000058956
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PGPEP1L pAb (ATL-HPA041781)
Datasheet Anti PGPEP1L pAb (ATL-HPA041781) Datasheet (External Link)
Vendor Page Anti PGPEP1L pAb (ATL-HPA041781) at Atlas Antibodies

Documents & Links for Anti PGPEP1L pAb (ATL-HPA041781)
Datasheet Anti PGPEP1L pAb (ATL-HPA041781) Datasheet (External Link)
Vendor Page Anti PGPEP1L pAb (ATL-HPA041781)