Anti PGLYRP2 pAb (ATL-HPA046311)

Atlas Antibodies

Catalog No.:
ATL-HPA046311-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: peptidoglycan recognition protein 2
Gene Name: PGLYRP2
Alternative Gene Name: PGLYRPL, PGRP-L, PGRPL, tagL, tagL-alpha, tagl-beta, TAGL-like
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079563: 61%, ENSRNOG00000042318: 58%
Entrez Gene ID: 114770
Uniprot ID: Q96PD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LMSAPNSGPHNRLYHFLLGAWSLNATELDPCPLSPELLGLTKEVARHDVREGKEYGVVLAPDGSTVAVEPLLAGLEAGLQGRRVINLPLDSMAAPWETGDTFPDVVA
Gene Sequence LMSAPNSGPHNRLYHFLLGAWSLNATELDPCPLSPELLGLTKEVARHDVREGKEYGVVLAPDGSTVAVEPLLAGLEAGLQGRRVINLPLDSMAAPWETGDTFPDVVA
Gene ID - Mouse ENSMUSG00000079563
Gene ID - Rat ENSRNOG00000042318
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PGLYRP2 pAb (ATL-HPA046311)
Datasheet Anti PGLYRP2 pAb (ATL-HPA046311) Datasheet (External Link)
Vendor Page Anti PGLYRP2 pAb (ATL-HPA046311) at Atlas Antibodies

Documents & Links for Anti PGLYRP2 pAb (ATL-HPA046311)
Datasheet Anti PGLYRP2 pAb (ATL-HPA046311) Datasheet (External Link)
Vendor Page Anti PGLYRP2 pAb (ATL-HPA046311)