Anti PGLYRP2 pAb (ATL-HPA046311)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046311-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: PGLYRP2
Alternative Gene Name: PGLYRPL, PGRP-L, PGRPL, tagL, tagL-alpha, tagl-beta, TAGL-like
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079563: 61%, ENSRNOG00000042318: 58%
Entrez Gene ID: 114770
Uniprot ID: Q96PD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LMSAPNSGPHNRLYHFLLGAWSLNATELDPCPLSPELLGLTKEVARHDVREGKEYGVVLAPDGSTVAVEPLLAGLEAGLQGRRVINLPLDSMAAPWETGDTFPDVVA |
| Gene Sequence | LMSAPNSGPHNRLYHFLLGAWSLNATELDPCPLSPELLGLTKEVARHDVREGKEYGVVLAPDGSTVAVEPLLAGLEAGLQGRRVINLPLDSMAAPWETGDTFPDVVA |
| Gene ID - Mouse | ENSMUSG00000079563 |
| Gene ID - Rat | ENSRNOG00000042318 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PGLYRP2 pAb (ATL-HPA046311) | |
| Datasheet | Anti PGLYRP2 pAb (ATL-HPA046311) Datasheet (External Link) |
| Vendor Page | Anti PGLYRP2 pAb (ATL-HPA046311) at Atlas Antibodies |
| Documents & Links for Anti PGLYRP2 pAb (ATL-HPA046311) | |
| Datasheet | Anti PGLYRP2 pAb (ATL-HPA046311) Datasheet (External Link) |
| Vendor Page | Anti PGLYRP2 pAb (ATL-HPA046311) |