Anti PGLYRP1 pAb (ATL-HPA045702 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045702-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: PGLYRP1
Alternative Gene Name: PGLYRP, PGRP, PGRP-S, PGRPS, TAG7, TNFSF3L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030413: 71%, ENSRNOG00000013395: 68%
Entrez Gene ID: 8993
Uniprot ID: O75594
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQN |
| Gene Sequence | PMSIGISFMGNYMDRVPTPQAIRAAQGLLACGVAQGALRSNYVLKGHRDVQRTLSPGNQLYHLIQN |
| Gene ID - Mouse | ENSMUSG00000030413 |
| Gene ID - Rat | ENSRNOG00000013395 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PGLYRP1 pAb (ATL-HPA045702 w/enhanced validation) | |
| Datasheet | Anti PGLYRP1 pAb (ATL-HPA045702 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PGLYRP1 pAb (ATL-HPA045702 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti PGLYRP1 pAb (ATL-HPA045702 w/enhanced validation) | |
| Datasheet | Anti PGLYRP1 pAb (ATL-HPA045702 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PGLYRP1 pAb (ATL-HPA045702 w/enhanced validation) |