Anti PGLS pAb (ATL-HPA042032 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042032-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: PGLS
Alternative Gene Name: 6PGL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031807: 87%, ENSRNOG00000018326: 87%
Entrez Gene ID: 25796
Uniprot ID: O95336
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IVAPISDSPKPPPQRVTLTLPVLNAARTVIFVATGEGKAAVLKRILEDQEENPLPAALVQPHTGKLCWFL |
| Gene Sequence | IVAPISDSPKPPPQRVTLTLPVLNAARTVIFVATGEGKAAVLKRILEDQEENPLPAALVQPHTGKLCWFL |
| Gene ID - Mouse | ENSMUSG00000031807 |
| Gene ID - Rat | ENSRNOG00000018326 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti PGLS pAb (ATL-HPA042032 w/enhanced validation) | |
| Datasheet | Anti PGLS pAb (ATL-HPA042032 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PGLS pAb (ATL-HPA042032 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti PGLS pAb (ATL-HPA042032 w/enhanced validation) | |
| Datasheet | Anti PGLS pAb (ATL-HPA042032 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti PGLS pAb (ATL-HPA042032 w/enhanced validation) |