Anti PGLS pAb (ATL-HPA040744 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA040744-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: 6-phosphogluconolactonase
Gene Name: PGLS
Alternative Gene Name: 6PGL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031807: 87%, ENSRNOG00000018326: 86%
Entrez Gene ID: 25796
Uniprot ID: O95336
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YRTHLLSRLPIPESQVITINPELPVEEAAEDYAKKLRQAFQGDSIPVFDLLILGVGPDGHTCSLFPDHPLLQEREQ
Gene Sequence YRTHLLSRLPIPESQVITINPELPVEEAAEDYAKKLRQAFQGDSIPVFDLLILGVGPDGHTCSLFPDHPLLQEREQ
Gene ID - Mouse ENSMUSG00000031807
Gene ID - Rat ENSRNOG00000018326
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PGLS pAb (ATL-HPA040744 w/enhanced validation)
Datasheet Anti PGLS pAb (ATL-HPA040744 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PGLS pAb (ATL-HPA040744 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti PGLS pAb (ATL-HPA040744 w/enhanced validation)
Datasheet Anti PGLS pAb (ATL-HPA040744 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti PGLS pAb (ATL-HPA040744 w/enhanced validation)