Anti PGLS pAb (ATL-HPA040744 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA040744-25

Protein Description: 6-phosphogluconolactonase
Gene Name: PGLS
Alternative Gene Name: 6PGL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031807: 87%, ENSRNOG00000018326: 86%
Entrez Gene ID: 25796
Uniprot ID: O95336
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YRTHLLSRLPIPESQVITINPELPVEEAAEDYAKKLRQAFQGDSIPVFDLLILGVGPDGHTCSLFPDHPLLQEREQ
• Gene Sequence: YRTHLLSRLPIPESQVITINPELPVEEAAEDYAKKLRQAFQGDSIPVFDLLILGVGPDGHTCSLFPDHPLLQEREQ
• Gene ID - Mouse: ENSMUSG00000031807
• Gene ID - Rat: ENSRNOG00000018326
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.