Anti PGAP3 pAb (ATL-HPA016591)

Atlas Antibodies

Catalog No.: ATL-HPA016591-25

Protein Description: post-GPI attachment to proteins 3
Gene Name: PGAP3
Alternative Gene Name: CAB2, MGC9753, PER1, PERLD1, PP1498
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038208: 92%, ENSRNOG00000046143: 91%
Entrez Gene ID: 93210
Uniprot ID: Q96FM1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SQGDREPVYRDCVLQCEEQNCSGGALNHFRSRQPIYMSLAGWTCRDDCKYECMWVTVGLYLQEGHKVPQFHGKWP
• Gene Sequence: SQGDREPVYRDCVLQCEEQNCSGGALNHFRSRQPIYMSLAGWTCRDDCKYECMWVTVGLYLQEGHKVPQFHGKWP
• Gene ID - Mouse: ENSMUSG00000038208
• Gene ID - Rat: ENSRNOG00000046143
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.