Anti PGA3 pAb (ATL-HPA046875)

Atlas Antibodies

Catalog No.:
ATL-HPA046875-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: pepsinogen 3, group I (pepsinogen A)
Gene Name: PGA3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024738: 63%, ENSRNOG00000054671: 61%
Entrez Gene ID: 643834
Uniprot ID: P0DJD8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYI
Gene Sequence GTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYI
Gene ID - Mouse ENSMUSG00000024738
Gene ID - Rat ENSRNOG00000054671
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PGA3 pAb (ATL-HPA046875)
Datasheet Anti PGA3 pAb (ATL-HPA046875) Datasheet (External Link)
Vendor Page Anti PGA3 pAb (ATL-HPA046875) at Atlas Antibodies

Documents & Links for Anti PGA3 pAb (ATL-HPA046875)
Datasheet Anti PGA3 pAb (ATL-HPA046875) Datasheet (External Link)
Vendor Page Anti PGA3 pAb (ATL-HPA046875)