Anti PEX11B pAb (ATL-HPA050104)

Atlas Antibodies

Catalog No.:
ATL-HPA050104-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: peroxisomal biogenesis factor 11 beta
Gene Name: PEX11B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028102: 93%, ENSRNOG00000021216: 93%
Entrez Gene ID: 8799
Uniprot ID: O96011
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LNRALYFACDNVLWAGKSGLAPRVDQEKWAQRSFRYYLFSLIMNLSRDAYEIRLLMEQESSACSRRLKGSGGG
Gene Sequence LNRALYFACDNVLWAGKSGLAPRVDQEKWAQRSFRYYLFSLIMNLSRDAYEIRLLMEQESSACSRRLKGSGGG
Gene ID - Mouse ENSMUSG00000028102
Gene ID - Rat ENSRNOG00000021216
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PEX11B pAb (ATL-HPA050104)
Datasheet Anti PEX11B pAb (ATL-HPA050104) Datasheet (External Link)
Vendor Page Anti PEX11B pAb (ATL-HPA050104) at Atlas Antibodies

Documents & Links for Anti PEX11B pAb (ATL-HPA050104)
Datasheet Anti PEX11B pAb (ATL-HPA050104) Datasheet (External Link)
Vendor Page Anti PEX11B pAb (ATL-HPA050104)