Anti PEX10 pAb (ATL-HPA049755)

Atlas Antibodies

Catalog No.:
ATL-HPA049755-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: peroxisomal biogenesis factor 10
Gene Name: PEX10
Alternative Gene Name: RNF69
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029047: 87%, ENSRNOG00000024012: 87%
Entrez Gene ID: 5192
Uniprot ID: O60683
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QRARKEWRLHRGLSHRRASLEERAVSRNPLCTLCLEERRHPTATPCGHLFCWECITAWCSSKAECPLCREKFPPQK
Gene Sequence QRARKEWRLHRGLSHRRASLEERAVSRNPLCTLCLEERRHPTATPCGHLFCWECITAWCSSKAECPLCREKFPPQK
Gene ID - Mouse ENSMUSG00000029047
Gene ID - Rat ENSRNOG00000024012
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PEX10 pAb (ATL-HPA049755)
Datasheet Anti PEX10 pAb (ATL-HPA049755) Datasheet (External Link)
Vendor Page Anti PEX10 pAb (ATL-HPA049755) at Atlas Antibodies

Documents & Links for Anti PEX10 pAb (ATL-HPA049755)
Datasheet Anti PEX10 pAb (ATL-HPA049755) Datasheet (External Link)
Vendor Page Anti PEX10 pAb (ATL-HPA049755)