Anti PET117 pAb (ATL-HPA047716)

Atlas Antibodies

Catalog No.:
ATL-HPA047716-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: PET117 homolog (S. cerevisiae)
Gene Name: PET117
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098387: 85%, ENSRNOG00000014173: 35%
Entrez Gene ID: 100303755
Uniprot ID: Q6UWS5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GVHVKQQWDQQRLRDGVIRDIERQIRKKENIRLLGEQIILTEQLEAEREKMLL
Gene Sequence GVHVKQQWDQQRLRDGVIRDIERQIRKKENIRLLGEQIILTEQLEAEREKMLL
Gene ID - Mouse ENSMUSG00000098387
Gene ID - Rat ENSRNOG00000014173
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PET117 pAb (ATL-HPA047716)
Datasheet Anti PET117 pAb (ATL-HPA047716) Datasheet (External Link)
Vendor Page Anti PET117 pAb (ATL-HPA047716) at Atlas Antibodies

Documents & Links for Anti PET117 pAb (ATL-HPA047716)
Datasheet Anti PET117 pAb (ATL-HPA047716) Datasheet (External Link)
Vendor Page Anti PET117 pAb (ATL-HPA047716)