Anti PERP pAb (ATL-HPA022269 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA022269-25

Protein Description: PERP, TP53 apoptosis effector
Gene Name: PERP
Alternative Gene Name: dJ496H19.1, KCP1, KRTCAP1, PIGPC1, THW
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019851: 82%, ENSRNOG00000011994: 82%
Entrez Gene ID: 64065
Uniprot ID: Q96FX8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAW
• Gene Sequence: LQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAW
• Gene ID - Mouse: ENSMUSG00000019851
• Gene ID - Rat: ENSRNOG00000011994
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PERP pAb (ATL-HPA022269 w/enhanced validation) – 1 Found

Duchatelet, Sabine; Boyden, Lynn M; Ishida-Yamamoto, Akemi; Zhou, Jing; Guibbal, Laure; Hu, Ronghua; Lim, Young H; Bole-Feysot, Christine; Nitschké, Patrick; Santos-Simarro, Fernando; de Lucas, Raul; Milstone, Leonard M; Gildenstern, Vanessa; Helfrich, Yolanda R; Attardi, Laura D; Lifton, Richard P; Choate, Keith A; Hovnanian, Alain. Mutations in PERP Cause Dominant and Recessive Keratoderma. The Journal Of Investigative Dermatology. 2019;139(2):380-390.