Anti PEPD pAb (ATL-HPA072045)

Atlas Antibodies

Catalog No.:
ATL-HPA072045-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: peptidase D
Gene Name: PEPD
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063931: 91%, ENSRNOG00000037188: 25%
Entrez Gene ID: 5184
Uniprot ID: P12955
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DVDTGKSTLFVPRLPASHATWMGKIHSKEHFKEKYAVDDVQYVDEIASVLTSQKPSVLLTLRGVNTDSGSVCREASFDGISK
Gene Sequence DVDTGKSTLFVPRLPASHATWMGKIHSKEHFKEKYAVDDVQYVDEIASVLTSQKPSVLLTLRGVNTDSGSVCREASFDGISK
Gene ID - Mouse ENSMUSG00000063931
Gene ID - Rat ENSRNOG00000037188
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti PEPD pAb (ATL-HPA072045)
Datasheet Anti PEPD pAb (ATL-HPA072045) Datasheet (External Link)
Vendor Page Anti PEPD pAb (ATL-HPA072045) at Atlas Antibodies

Documents & Links for Anti PEPD pAb (ATL-HPA072045)
Datasheet Anti PEPD pAb (ATL-HPA072045) Datasheet (External Link)
Vendor Page Anti PEPD pAb (ATL-HPA072045)