Anti PEMT pAb (ATL-HPA042375)

Atlas Antibodies

Catalog No.: ATL-HPA042375-25

Protein Description: phosphatidylethanolamine N-methyltransferase
Gene Name: PEMT
Alternative Gene Name: PEMPT, PEMT2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000301: 87%, ENSRNOG00000054423: 87%
Entrez Gene ID: 10400
Uniprot ID: Q9UBM1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GFAGTFLGDYFGILKEARVTVFPFNILDNPMYWGSTANYLGWAIM
• Gene Sequence: GFAGTFLGDYFGILKEARVTVFPFNILDNPMYWGSTANYLGWAIM
• Gene ID - Mouse: ENSMUSG00000000301
• Gene ID - Rat: ENSRNOG00000054423
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti PEMT pAb (ATL-HPA042375) – 1 Found

Wattacheril, Julia; Seeley, Erin H; Angel, Peggi; Chen, Heidi; Bowen, Benjamin P; Lanciault, Christian; Caprioli, Richard M; Abumrad, Naji; Flynn, Charles Robb. Differential intrahepatic phospholipid zonation in simple steatosis and nonalcoholic steatohepatitis. Plos One. 8(2):e57165.